KEGG   Astyanax mexicanus (Mexican tetra): 103043321Help
Entry
103043321         CDS       T05042                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04210  Apoptosis
amex04625  C-type lectin receptor signaling pathway
amex04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103043321
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103043321
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103043321
   04672 Intestinal immune network for IgA production
    103043321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103043321
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103043321
Protein kinases [BR:amex01001]
 Serine/threonine kinases: STE group
  Other
   103043321
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 103043321
NCBI-ProteinID: XP_007229999
Ensembl: ENSAMXG00000005213
LinkDB All DBs
Position
2
AA seq 891 aa AA seqDB search
MAAVQRFFNSTMPFSDAKDQQKIVGCHYPMPEPHAAGTAGKNELHKQILGTALLKAIYQG
TAKQVGTGSLGTEKSSFIAQAECESQDSQEFCPNTRLQNNIYSEVSTSLSCTQRSASRRR
PRKKRRKRRRRQGEREGQRPDEERERVRERRLTGVPEQDSGEVGQCIYSSQSSSSYSSTS
SSSSRSSAVSTESLSVQETAQPHHNLHSTPLSSPHCPHWRPLQTQPSCDLYGQECQSSVD
SSLVSETECQLAVQGLRNYVTNAERCYAPAFAREMVKEEEERQQQQEEAEDEEEGWEEND
TNEGILFEKKLNPKNYEYREGTDYEVYGLIKQGSYGDVYSIRDKSSGFICAAKKVPLKGF
SSEEVGSWSALKAPHVVELFGFVREGASVILFMDRKPGCLGQLLKERGRLPEDLSLHYLH
QVLGALEHLHKRRILHLDIKVDNVLLSEDGKDAFLCDFGESERLDHHGFSPYKGLKGTET
HMAPEVARGDQRCAKADVWSSCCMLLHMLNGCQPWIRYYSHPLCLKIAEEPPPLREIPAD
CSSYTADAIKRGLQKDPSQRSSAKDLRLLTAKALKQLGGLRSPAKGGAYQKPIEKPERRD
AAPLSRSSVQQWMGSEQKRREGAGVREGLENTSTSDDEPEEVVSEEEEPEEEEDDGDEEQ
EDRINRRNKRCPPQASTLYIHPPNPEPSELTEQELQLRKLERDFFLSSLSQPHSAELQEQ
LLSCLGSDCPSAREPWEKKDSGRWSVGPGDDLSSGVFSYNSQSDGQSFSMDWLVPAHQPP
PRCFEGVDVCIRDFNGRCFRIRETPRVKVGHIAVGISDQISENVFSLQGEDGSLVPHDKE
VQETGLFLRCVPAPDCSHAPCCRRAPSCRHPPCCKTPWSWRVRDGVLESKD
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtacagaggtttttcaactccaccatgcccttttccgatgccaaagaccag
caaaagatagttggttgtcactaccccatgccagaaccacatgcagcaggcaccgctggc
aaaaacgagctccataagcagattcttggtacagcccttttgaaggccatctatcaagga
acagccaagcaagtgggaacggggtctctggggacagagaagtcatcctttattgcccag
gcagagtgtgaatctcaggactcgcaggaattctgccctaacaccagactccaaaataac
atctacagtgaagtcagcacttccctctcttgcactcagaggtcagccagtcgccggcgg
ccgcggaaaaagcgtcgaaagaggcgacggaggcagggggagagggagggtcagcggccg
gatgaagagagggagagagtgagagagaggagactgactggagtgccagaacaggacagt
ggagaggtgggacagtgtatctacagcagtcaaagcagcagctcttacagcagtaccagt
agcagcagcagcagaagcagtgctgttagcacagagagcctgtctgtgcaggagacagct
cagcctcaccacaaccttcacagcacacccctttcctccccacactgcccacactggagg
cccctccagactcagccgtcctgtgacctctatggccaggagtgtcaaagttcggttgac
tcgtctctggtcagtgagacagagtgccagctggctgtccagggtctccgaaactacgtc
acaaacgccgaaagatgctacgcaccagctttcgccagagaaatggtcaaagaagaggag
gagagacagcagcagcaggaggaggcggaggatgaggaggaagggtgggaggaaaatgac
acaaacgaagggattctcttcgaaaagaaactcaatcccaaaaactatgaatatcgggag
gggacggattatgaagtttatggtttgataaagcaaggctcatatggagacgtgtacagc
atcagggacaaatccagtggcttcatctgcgctgccaaaaaggtgccattaaagggattc
agttctgaggaggtgggctcgtggagtgccctcaaagctcctcatgtggtggaactcttt
ggatttgtgcgagaaggtgcatctgtgattctttttatggatcgtaaacctggctgtctg
gggcagttgctaaaggagaggggccgtctgcctgaggatctctccctgcactacctgcac
caagtgttgggggcgctggaacatctgcataagaggcgcatcctgcacctggacatcaaa
gttgataatgtgttgctgtctgaagatgggaaagatgcgttcctttgtgactttggagag
tcagagcgattagaccatcatggattcagtccttacaaaggtctgaagggtacagagaca
cacatggctcctgaagtggcacgcggagaccagcgctgcgccaaggcggacgtgtggagc
agctgctgcatgcttctgcacatgctcaatggctgccagccctggatccgatactactcc
caccctctttgtctgaagatagccgaagagccgccacccctaagggagatcccggctgac
tgcagctcatatactgctgacgccattaaacgaggactgcagaaagacccgagccaaaga
tcttcggccaaggatctcagactgctaacagccaaagcacttaaacaattgggaggtctt
cgtagccctgcgaagggaggagcctatcagaaaccaatagagaagccagagaggcgtgat
gccgcccctctctcccgtagctctgtgcagcagtggatgggctcagagcaaaagcggaga
gagggggctggagtgagggaagggctggagaacacgagcaccagtgacgacgaaccagag
gaggtggtcagtgaagaggaggagccagaggaggaggaagatgacggtgatgaagaacaa
gaggatagaataaatagaagaaataagagatgtcctcctcaagcttcaacgctctatatc
caccctccaaacccagaacccagtgaactcaccgagcaggagctccagctacgcaaactt
gagagggatttcttcctaagtagcctgtctcagcctcactccgctgaactacaggaacag
ctcctgtcctgcctgggcagtgactgcccctctgccagagagccatgggaaaagaaggat
tcgggacgctggtccgtcggccctggcgatgacctcagctcaggtgtgttctcctacaac
agccaatcggacggccagagcttcagcatggactggcttgttccagcccatcagcctccg
ccccgctgctttgagggagttgatgtttgcatcagggattttaacggacgctgcttccgt
atccgtgaaacaccccgggtgaaagtgggccacattgctgtaggaatcagtgatcagatc
tccgagaatgtgttcagtctgcagggtgaggacggttctctggtgcctcatgataaggaa
gtgcaggaaacgggccttttcctgcgctgcgtccccgccccagactgtagccacgccccc
tgctgcagacgagctccaagctgcagacaccccccctgctgcaaaacaccatggagctgg
agagtacgcgatggagtgctggagagcaaagattga

DBGET integrated database retrieval system