KEGG   Astyanax mexicanus (Mexican tetra): 103043721Help
Entry
103043721         CDS       T05042                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00020  Citrate cycle (TCA cycle)
amex00310  Lysine degradation
amex00380  Tryptophan metabolism
amex01100  Metabolic pathways
amex01200  Carbon metabolism
Module
amex_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103043721
  09105 Amino acid metabolism
   00310 Lysine degradation
    103043721
   00380 Tryptophan metabolism
    103043721
Enzymes [BR:amex01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     103043721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 103043721
NCBI-ProteinID: XP_007249544
Ensembl: ENSAMXG00000012121
UniProt: W5KY07
LinkDB All DBs
Position
25
AA seq 1010 aa AA seqDB search
MSQFRPLAGVLRGSGLWMLGRTGPGRQVFNPHRGCSSRATQPSPSALSSSYVEEMYYSWL
EDPKNVHESWDAYFRNAQASSPAAEAEERRPSTLLQGRALSQTPAMSQKVVEDHLAVHNL
IRAYQIRGHHVAQLDPLGILTADVDSFVPSDLITTIDKLGFYGLDESDLDKTFQLPSTTF
IGGQQTTLPLREIIRRLETSYCGHIGVEFMFINNVEQCQWIRQKFESPGIMKFTEKEKRT
LLARLVRSTRFEDFLARKWSSEKRFGLEGCEVLIPALKMIIDKSSAAGIESVIMGMPHRG
RLNVLANVVRKDLDQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRETDKDITLSLMAN
PSHLEAVDPVVQGKTKAEQFYRGDTEGKKVMSILMHGDAAFAGQGVVYETFHLSELPSYT
TQGTIHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMHVCRVAAEW
RSTFNKDVVIDLVCYRRFGHNEMDEPMFTQPLMYKQIRKQEHVLKKYADKLISEGVVTLQ
EFEEEVAKYDKICEEAYTSSKDEKILHIRHWLDSPWPNFFTIEGEPKRMSYPPTGLNEEV
LKHIGKTASSVPLQDFSIHSGLSRILRGRSDMISKRTVDWALAEYMAFGSLLKDEIHVRL
SGQDVERGTFSHRHHVLHDQEVDKRFCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGFA
MANPNALVCWEAQFGDFHNTAQCIIDQFISSGQAKWVRNNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSKDDPDRYPEFTGDFEVQQLFDCNWIVVNCSTPANYFHVLRRQILLPFRKPL
IIFTPKSLLRLPEARSSFDEMTTETKFRRIIPDEGSASKNPSKVKRVIFCTGKVYYELAK
ERKQLKLEDVVAIVRLEQISPFPFDLIKAEVEKHPNAELIWCQEEHKNMGYYDYVRPRFL
TVLSNKKPIWYVGRDPAAAPATGNKFTHLAELKRFMDTAFDLSAFEGRSF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtttcggccacttgccggtgtcctgcggggcagtggcctgtggatgttgggt
cgtactgggccaggaagacaagtgtttaaccctcatcgaggctgttcctctagagctact
cagccatccccttcagccctcagttccagctatgtggaggaaatgtattattcctggctt
gaagaccccaaaaatgttcatgagtcttgggatgcatactttcgcaatgcccaggcaagc
agtccagcagcagaagcagaagagaggcgtccgtccactctcctccagggtcgagccctg
tctcagactccagcaatgtcccaaaaggtggtggaagatcacctggctgtccacaacctt
atcagagcctaccagatccggggtcatcatgtggcccagctggacccccttggcatcctt
acagctgacgttgattcttttgtcccttcggatttgataacaaccattgacaagcttggg
ttctatggcctggatgaatctgatttggacaagacctttcagttgccatcaacaacattt
attggtgggcaacaaaccacacttcctctcagggaaatcattcgtagacttgagacttca
tactgtggtcatattggtgtggagttcatgttcataaacaacgtagagcagtgtcagtgg
atcaggcaaaagtttgaaagtccaggcatcatgaaattcactgaaaaagagaagaggaca
ctgctggccaggctggtgcgttcaacacggtttgaggatttcctggcccgtaaatggtct
tcagagaagcgctttggccttgaaggctgtgaagttctaattcctgccttgaagatgatc
attgacaagtctagtgcagccggtatagagagcgtgatcatgggcatgcctcacagaggt
cggctgaacgtgctggctaatgttgttcggaaagatctggatcagattttctgccagttt
gatcccaaacttgaagctgcagatgagggctcaggagatgtgaagtatcacttgggtatg
tatcacgagcggatcaaccgggagacggataaggacatcaccctgtctctcatggctaac
ccctcccaccttgaggcagtggaccctgtagtgcagggcaaaaccaaagcagagcagttc
tacagaggagacacagaggggaagaaggtgatgtcgattctgatgcatggtgatgcagca
tttgctggtcaaggagtggtctatgaaacattccatcttagtgaactgccctcatacacc
actcagggcaccatacacgttgttgtcaacaatcagattggtttcaccactgatccacga
atggcacgctcttctccttaccccactgacgtggctcgcgtggtcaatgcaccaatcttt
catgtcaacgcagatgaccctgaggctgtgatgcatgtgtgcagagtggctgcagaatgg
agaagcacctttaacaaggatgtggtcattgacctggtgtgttaccgacgctttgggcac
aatgagatggatgagcccatgtttactcagcctctcatgtacaagcagattcgcaagcaa
gagcatgtactgaagaaatatgcagacaagcttatctctgagggagtggttactctgcag
gagtttgaggaggaagtggctaaatatgacaaaatctgtgaagaagcgtacaccagctcc
aaagacgagaagatcctacacatccgccactggctcgactcaccctggccaaacttcttc
acaattgagggtgaacccaagcggatgagctatcctcctactggactaaacgaggaagtc
ctgaagcacattggcaagactgccagctctgtccctctgcaggacttttccattcacagt
ggactgtcaaggatcttacgaggccggtctgacatgattagtaaacgtacagtggactgg
gctctggcagagtatatggcttttggctccctgctgaaggatgagatccatgtgagactg
agtggacaggatgtggagagaggaaccttcagtcaccgtcatcatgtcctgcatgaccag
gaggtggacaagcggttttgtgtcccaatgaaccatctatggccggaccaagccccttac
actgtgtgcaacagctctctgtccgagtatggagttctgggttttgagctggggttcgcg
atggctaatcccaatgcacttgtgtgttgggaggctcagtttggggacttccacaacaca
gcacagtgcataattgaccagttcatcagttcaggtcaggccaaatgggtccgcaacaat
ggcatcgtcctgcttctgccccatggaatggagggaatggggccagagcactcgtcagca
cggcctgagcgtttcttgcagatgagcaaggatgaccctgatcgctatccggaattcact
ggagactttgaggtccaacagctttttgactgtaactggatcgtggtcaactgctcaaca
cctgccaactactttcatgtgctgaggaggcagatcttattaccattcagaaagccgcta
atcatttttactcccaagtccttgctgaggcttcctgaagcccggtccagttttgatgag
atgaccacagaaacaaagttcagaagaatcataccagatgagggttctgcatcgaaaaat
ccaagcaaggtgaagagggtcatcttctgcactggaaaagtctactatgagctggcaaaa
gagaggaaacagctcaagttagaagatgtggttgcaattgttcgactggaacagatatca
ccattcccttttgacctcatcaaggctgaagttgagaagcatcctaatgctgagctcatc
tggtgtcaggaggagcataagaacatgggttattatgactatgtaagaccacgcttcctc
actgtgctgtccaacaagaaaccaatatggtacgttggtcgggaccctgctgcagcccca
gccacaggaaacaagttcacccacctggcagagctcaagaggttcatggacactgcattt
gacctcagtgcctttgagggaaggagcttttga

DBGET integrated database retrieval system