KEGG   Astyanax mexicanus (Mexican tetra): 103043782Help
Entry
103043782         CDS       T05042                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04110  Cell cycle
amex04114  Oocyte meiosis
amex04120  Ubiquitin mediated proteolysis
amex04914  Progesterone-mediated oocyte maturation
Module
amex_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:amex00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103043782 (cdc23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103043782 (cdc23)
   04114 Oocyte meiosis
    103043782 (cdc23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103043782 (cdc23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:amex04121]
    103043782 (cdc23)
   03036 Chromosome and associated proteins [BR:amex03036]
    103043782 (cdc23)
Ubiquitin system [BR:amex04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     103043782 (cdc23)
Chromosome and associated proteins [BR:amex03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    103043782 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_16 TPR_11 TPR_19 ANAPC3 TPR_12 TPR_7 TPR_17 TPR_9 POTRA_3 TPR_15
Motif
Other DBs
NCBI-GeneID: 103043782
NCBI-ProteinID: XP_022532061
LinkDB All DBs
Position
14
AA seq 578 aa AA seqDB search
MAALSVELQDLVGVKQQLVKIQEQCRERGLVHSAKWASELAFALNPLPLNKLPSPPELTE
EDAQDLDALCLAKSYFDLKEYDRAAYFLRGCRSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVRNEALRELRVELSKKHSAGELDGFSLYLYGVVLRKLDLLKEAVDIFVAATHA
LPLHWGAWLELCNLITNIEMLKSLSLPDCWVRDFFMAHMYTELQMIKEALQKYQSLMEAG
FAKSTYIISQIAVAYHNIRDIDQALDLFNELREQDPFRIENMDTFSNLLYVRSMKPELSY
LAHNLVEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRCLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYSLYYYRKAHQLRPNDSRMLVA
LGECYEKLSQQVEAKKCYWRAYSVGDVERMALLKLAKLHEQLNESDDAAQSYIIYIQDIF
SCGEQLEHAEVSTALRYLGQYYFKNKLYDEASLCAQRCCDYNDAREEGKALLRQISAVRE
QGEPSSTDLSLPSVFNPLSSNTTPVRRVSPLDLSSVTP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcagtgtggagctccaggacctggtcggagttaaacagcagctggtgaag
attcaggagcagtgcagggagcgggggctggtccacagcgctaaatgggcttccgagttg
gcatttgctctcaatcctctcccacttaacaagctgccctcgccgcctgagctgactgag
gaggacgctcaggatctggatgctctctgtctggctaagtcctattttgacctgaaggag
tatgaccgagctgcgtacttcctccgaggctgccgcagtcagaaagcctactttctttat
atgtactcacgctatttgtctggagagaagaaaaaggatgatgagactgtggacagtctg
ggtcctctggagaaagggcaggtgcggaacgaggctctgcgggagctgagggtggagctc
agtaagaagcacagcgctggagagttggatggattctccctctacctgtacggtgtggtg
ctgcggaagctggacctgctgaaagaagctgtggacatctttgtggctgcgactcatgct
cttcctttgcactggggagcctggctggagctctgcaacctcatcaccaatatcgaaatg
ctgaagtccctgtctctgccagactgctgggtgagggacttcttcatggcacacatgtac
actgagctgcagatgattaaagaagcgctgcagaagtaccagagcctgatggaggctgga
ttcgccaagagcacctacatcatctctcagatcgctgtagcttatcacaacatcagagat
atcgaccaagccttagatttgtttaatgaacttcgggagcaggatcctttcagaattgag
aacatggacaccttctccaacctgctgtatgtcaggagcatgaagccagagctgagctat
ttggcccataacctggtggagattgataagtatagagtggagacctgctgtgtgattggt
aattactacagtctgcgctcgcagcacgagaaggcggcgctgtatttccaaagagctctg
aagctgaacccgcgctgcctgggggcctggacgctcatgggtcacgaatacatggagatg
aagaacacttccgctgccatccaagcctacagacacgctatagaggtgaataagagggac
tatcgagcctggtatggacttggacagacatacgaaatcctaaaaatgcctttttactcg
ctctactactacaggaaagcccaccagctcaggccgaatgactcccgcatgctggtggct
ctgggagaatgctatgagaaactctcacaacaggttgaggctaaaaagtgttactggaga
gcgtactctgtaggagacgtggagagaatggcacttctcaaactggcaaaacttcacgag
cagttaaacgagtcagacgacgcagcacaatcttacatcatctacatccaggacattttc
tcctgtggagaacagctggagcatgcggaggtcagcacagctctgcgatatctcggtcaa
tactacttcaagaataaactctatgatgaggcgtctctctgtgctcagcgctgctgcgac
tacaacgatgcgcgtgaggaggggaaggctcttctgaggcagatctctgctgtacgggag
cagggagagccgtcttccactgacctctccttacccagcgtcttcaaccccctctccagc
aacaccacccctgtcagaagagtgtccccactggacctgtcctccgtcacaccctaa

DBGET integrated database retrieval system