KEGG   Astyanax mexicanus (Mexican tetra): 103043929
Entry
103043929         CDS       T05042                                 

Gene name
ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04210  Apoptosis
amex04620  Toll-like receptor signaling pathway
amex04621  NOD-like receptor signaling pathway
amex04622  RIG-I-like receptor signaling pathway
amex04623  Cytosolic DNA-sensing pathway
amex04625  C-type lectin receptor signaling pathway
amex04920  Adipocytokine signaling pathway
amex05132  Salmonella infection
amex05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103043929 (ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103043929 (ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103043929 (ikbkg)
   04621 NOD-like receptor signaling pathway
    103043929 (ikbkg)
   04622 RIG-I-like receptor signaling pathway
    103043929 (ikbkg)
   04623 Cytosolic DNA-sensing pathway
    103043929 (ikbkg)
   04625 C-type lectin receptor signaling pathway
    103043929 (ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103043929 (ikbkg)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103043929 (ikbkg)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103043929 (ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103043929 (ikbkg)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103043929 (ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 CENP-F_leu_zip TMF_TATA_bd DHR10 Peptidase_M27
Other DBs
NCBI-GeneID: 103043929
NCBI-ProteinID: XP_007250007
Ensembl: ENSAMXG00000017836
UniProt: A0A3B1IHW7
LinkDB
Position
15
AA seq 611 aa
MVQPQPHGGGTLQWEMTGEEAVGAASQGSLMASSQGSLRVPPELAGNEVVHRLLADNHQL
REALKRSNDALKDRCEEMEGWQRRSREEREFLSCKFREARALVERLAQENHSLLGKLNHS
VSLSAGLSPGNSPEAGSSDKNLEGCSAESNGLIHSPETFEETALKDGVEEDEERVHQSLA
SSDNSFLSSFPPSLHDALPYDEGQCWVEGDSRACQPSEGSNEFLKLLKSHKEKMEDGMRD
LRRKNEELEKEKMESEKEKEDLRTTVEQLHVELSQLKQTAVVAEETDFTVSPERSHLAKL
TEQLQATQGRYRELQEKLNALQHNSFQRDRVEAVLKQKEKDCVQLTKDIEALKAQVTSLL
GELHERQTCLNKCEEEKRHLEDKLRSKTEGLQNLEREMEQQKKQHFVTMDKLLLQTQNLE
AALKNERLVIVEERRKLAQLQHAYTCLFQDYDNKLKTEKQANRGGEAEILNRLEEAERAL
ALKQAHIDKLKEEMEQVRSLQETNQVLTAQAEIYKLDFQAEREAREKLNQKKEELQEKLN
QVLAEINLLKQENMQQRHKDDYRPHQLLPPGPSMPPQNRNPEVLPEFQCPKCQYRAPDMD
TLQIHVMDCIQ
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggttcaaccccagcctcacggaggcggcaccttacagtgggagatgactggtgaggag
gctgtaggggctgccagccaagggtcactaatggccagttcacaaggatctctgagggtt
ccacccgagttggctggaaacgaggtcgtccacagacttctggcagacaaccatcagtta
cgagaggccctgaaacgaagcaatgacgccctgaaggacaggtgtgaagagatggaggga
tggcagaggaggtctagggaagaacgagagttcctcagctgtaaatttcgcgaagcccgg
gcattagtggagcgactggctcaggagaatcacagtttgctgggcaagctcaaccatagt
gtcagtctctcagcaggtctgagtcctggcaattctcctgaggcaggaagttcggataaa
aacctagaaggctgcagtgcagagagtaatggactgattcactctcctgagacctttgaa
gagactgccttgaaggatggtgtagaagaagacgaagaaagagttcatcaaagcttggca
tctagtgacaatagcttcctcagtagtttccctcccagtctgcatgacgccctgccctat
gatgaagggcagtgctgggtggagggagacagcagggcctgtcagcctagtgaaggttct
aatgagttcttaaagctgctgaagagtcataaagagaagatggaggacggaatgagagat
ctcagaaggaagaatgaggaactggagaaagagaaaatggagagtgaaaaggagaaagag
gaccttcggactactgttgagcagcttcatgtggaactgtctcagctcaagcagactgct
gttgtagcagaggagacagatttcacagtttctccagaacgctctcacttggctaaacta
acagagcagcttcaggctacacaaggaaggtatagagagcttcaggaaaaactgaacgct
ctgcagcacaattcatttcagagggaccgagttgaggctgttctcaaacagaaagagaag
gactgtgttcagctgactaaggatattgaagcactgaaggctcaggtcacatctcttctt
ggggaactgcatgagcgccagacctgtcttaacaaatgtgaagaagaaaagagacattta
gaggacaagttacgcagtaagacagaaggcctgcagaatctggagcgggaaatggagcag
cagaagaagcagcacttcgtcaccatggacaaactactgctgcagacacagaatttggag
gctgcactgaagaatgaaagacttgtcattgtggaggagagaagaaagctggcccagctc
cagcacgcatacacctgtctgtttcaagattatgacaacaagctgaaaacagaaaaacaa
gcaaacaggggcggagaggcggagattcttaacagattggaggaagctgagagagctctg
gctttgaaacaggctcacattgacaaactcaaggaggaaatggagcaagtgaggagccta
caggagactaatcaagtgcttacagcacaggctgaaatctacaagctagatttccaggct
gagagagaagcacgagaaaagctcaatcagaagaaagaggagctgcaggagaagctgaac
caggttctggctgaaatcaacctactcaagcaggagaacatgcagcagagacacaaggat
gactatcgacctcatcagctcctaccacctggaccatcgatgcccccacagaaccgaaac
cctgaagtgctgccagagttccaatgtcctaagtgtcagtaccgtgcaccagacatggat
actctacagattcacgtgatggactgtatccaatga

DBGET integrated database retrieval system