KEGG   Astyanax mexicanus (Mexican tetra): 103044115Help
Entry
103044115         CDS       T05042                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex00052  Galactose metabolism
amex00500  Starch and sucrose metabolism
amex01100  Metabolic pathways
amex04142  Lysosome
Brite
KEGG Orthology (KO) [BR:amex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103044115 (gaa)
   00500 Starch and sucrose metabolism
    103044115 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103044115 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    103044115 (gaa)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103044115 (gaa)
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103044115 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 103044115
NCBI-ProteinID: XP_022529463
Ensembl: ENSAMXG00000006210
LinkDB All DBs
Position
2
AA seq 935 aa AA seqDB search
MNLYGFPHHLLTPVILIIAASCTLYISLLYFHQAPTIRLPPLTQLVNKYSVSVSVPNVRV
YTQSKPKVNFSNVDVHAGKDCGIAVERRFDCARDRALTQSQCEQRGCCYVPLPKSAFSGP
PWCFYPVSYPGYRMGPLVPTSRGQEANLTRSTSSYLPRDVQTLTLEVMAEEAGRLHIALK
DPSQDRYEVPFVAVPPTTPTDTQSFLYDVEFQPDPFGFVVRRASNGRVLLNTTVAPLLFA
DQYLQLSTTLASSLVSGFGEHYTGLTLDLNWTSVTLWNRDMAPHRDTNLYGSHPFCLVQE
GDGQAYGIFLLNSNAMEVVSQPAPALTWVTTGGIMDFYIFLGPDPQSVAQQYHQVIGYPM
MPPYWSLGFHLCRWGYTSTNATRAVVQHMHQANFPLDVQWNDLDYADKRRVFTFDPQRFG
DLPEMVKEFHSEGMKYVLILDPGISSTSPPGSYKPFDEGERRGVFIRNLTGQTLIGKVWP
GPTAFPDFTNPDAVSWWEECIADFYAKVPVDGLWIDMNEPANFVQGSLLGCPDTDLENPF
YVPDMIGGQLNAGTLCMSSQQSLSAHYNLHNLYGLTEAMATHSALLKARGSRPFVLSRSS
FPGLGRYSGHWTGDVHSDWEQLRYSIPAVLLFGLYGVPLVGADICGFEGDTSEELCVRWT
QLGAFYPFMRNHNDRSNAPQEPYVFGQQAQAAMRSVMMLRYSLLPFLYTLFHQAQTSAST
VARPLFLEFPFDPNCQTIDQQFLWGSSLLISPVLEQGAVELTAYLPPGMWYSLYDGQPYN
SRGQYLLLSAPLDTINVHVRGGRIIPQQMPALTTTASRSNPFLLTVALSSDGWAVGELFW
DDGESLGTFERGDYSFIIFTAEQSQLVSEPGKVNGALDGLVLGEIRVFGVLTPPSGVWAN
GKEVQDYSYCTGTKVLTVSSLSLLMSETFKVQWSS
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtatgggtttccacatcaccttttaactcctgttattttaattattgcagca
tcatgtactttgtacatcagtctgctgtattttcatcaagcacccacaataagacttcca
ccattaacacagttagttaataagtacagtgtctctgtatctgtcccaaatgtgagagtt
tacacccagagcaagcctaaagtaaacttcagtaatgttgatgttcatgctggaaaggac
tgtggtattgctgtggagaggaggtttgactgtgctcgggaccgagccctcactcagtca
cagtgtgagcagaggggctgctgctatgttcccctgcccaagtctgcattcagtggtccg
ccctggtgtttctaccctgtttcttatcctggctacagaatgggaccacttgttccaact
tcaaggggccaggaggccaaccttacccgctccaccagttcttaccttccccgggacgtc
caaacactgacactggaggtgatggcagaggaggcaggccgcctgcacatcgcactgaag
gatccatctcaggatcgttatgaggttcccttcgtcgcagtgcctcccaccactcccaca
gacactcagagcttcctctatgatgtggagttccagccagacccttttggctttgttgtg
cgacgtgcatccaatggccgagtactgctgaataccacagtagcccccctactgtttgca
gaccagtacctgcagctctccaccactctggcctcctctctcgtgtctggatttggggag
cactacactggactcacactggaccttaactggacctctgtcactctgtggaacagagac
atggctccacacagagatacaaatctatatggatcccatccattttgcttggttcaggaa
ggtgatggtcaggcgtatgggatcttcctcctcaacagcaatgctatggaagtggtatca
cagcctgctcctgcactaacctgggtgaccactggagggattatggacttctacatcttc
ttaggccctgatccacagagtgtcgcccagcagtaccatcaggttattggatatccaatg
atgccgccctattggtcgttgggattccatctctgccgctggggctacacctccaccaac
gctaccagagctgtagtgcagcacatgcaccaggccaactttcctctagatgtgcagtgg
aacgatcttgattacgctgacaagaggagagtgttcacctttgacccgcagaggtttgga
gacctgcctgagatggtgaaagagttccacagtgagggaatgaagtatgtgctcattttg
gacccaggcatcagcagcacaagccccccaggttcatacaaaccctttgacgagggagag
cggaggggggtgttcatcagaaacctcacaggacagactctcatcgggaaggtgtggccg
ggtccgaccgcattcccagacttcactaacccagacgcagtgagctggtgggaggagtgc
attgctgacttttatgccaaggtgccagtggacggcctgtggattgatatgaatgagcct
gctaattttgttcaaggctcgctgctcggatgcccagacactgacctggagaaccctttt
tatgttccagatatgatcggaggtcagttaaatgcaggtaccctgtgcatgtccagccag
cagtccctgtctgctcactacaacctgcacaacctgtacgggctaactgaggccatggcc
acccacagtgctttgctgaaagcgaggggttcccgtcccttcgtgttgtcccggtcctcc
ttccctggactgggtcgctactcaggtcactggactggtgatgtgcacagtgactgggag
cagctgcgatactccatacctgctgtgctgctgttcggtctgtatggggttcctctggtg
ggggcggatatttgtggttttgaaggagacaccagtgaggagctgtgcgtgcgctggacc
cagctaggagctttctacccgttcatgaggaaccacaatgaccgatccaatgctccccaa
gagccgtatgtgttcggacagcaggcccaggcagctatgaggagtgtgatgatgctcaga
tactctctgctgcccttcctctacactctgttccaccaggctcaaacctcagccagcact
gtggccagacccctgtttctagaatttccatttgatccaaactgccagaccatagaccag
cagttcctatgggggagttctctcctcatcagtcctgttctggagcagggagcagtggag
ctgacagcttacctccccccagggatgtggtacagtctgtatgatggacagccttacaac
agcagggggcagtacctgctgctttctgccccactagataccatcaacgtccatgtgaga
ggggggcgcattattccacagcagatgcctgctttaacaaccacagcctcacgcagtaac
cctttcctcctgacggtggcgctgtcctcagacggctgggcagtaggggagctgttctgg
gatgatggagagagtctgggcacttttgagcgtggagattactcctttattatcttcact
gcagaacagtctcagctggtgagtgagccaggaaaagtgaatggagctctggatggttta
gttttgggagagataagagtgtttggggttctaaccccaccttcaggtgtgtgggctaac
ggcaaggaagtgcaggattactcatactgcactggcaccaaggttcttacggtgtccagt
ctcagcctgctaatgtcagagacgtttaaagtgcagtggagttcatga

DBGET integrated database retrieval system