KEGG   Astyanax mexicanus (Mexican tetra): 103044267
Entry
103044267         CDS       T05042                                 

Gene name
pdgfra
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04020  Calcium signaling pathway
amex04144  Endocytosis
amex04510  Focal adhesion
amex04540  Gap junction
amex04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103044267 (pdgfra)
   04020 Calcium signaling pathway
    103044267 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103044267 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103044267 (pdgfra)
   04540 Gap junction
    103044267 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103044267 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103044267 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:amex04090]
    103044267 (pdgfra)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103044267 (pdgfra)
Protein kinases [BR:amex01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103044267 (pdgfra)
CD molecules [BR:amex04090]
 Proteins
  103044267 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE SKG6
Other DBs
NCBI-GeneID: 103044267
NCBI-ProteinID: XP_022520156
LinkDB
Position
3
AA seq 1449 aa
MGTVKTHLLLGVVLLGVLEVVCDLPPPTIVSNETQFVLPPHSVFNISCTGKQRVKWEEPL
PRNTHVLPGYYTATLLIDDAAAFHTGPYTCVYEAVETEPASISIFVPDPDVPFVPEEPNA
HEAEAWGSLIPCRVTNPRSNVILRTLPSGDEMPALYDASHGFLGRFSPGLYVCETVVNGK
AVQSVVYSVADDPDVKLRVSQQEVKEGEALNLTCETPPGFQYLQQWLHPSKQAAGAVQMK
QAFPDKVVYILNIPHASVADSGFYECSVTDISSSRAKSASVTVTVHGTSFLVLDHSGIGA
EETTPLLEETEFTFYIKSDSAPKVTWFKDDQELISNFATTKTVLLEDKRYESVLVLRHPV
EEDSGTYKIVASAGSQSAEFSFKLHVKASEPALLQSGLPPLIWPRKEEMVVSLHSSFRIT
CRGQEELSWSTPIHIDEPVSKDKRGLYVSTLTIDNASAIHTGEYTCSYNNGNQTDEAYIY
IYVPDPDAPFVPSLFPFINHVLTNHDGMEVPCLVSDPSANVTLILVETQQPVPAHYDSKR
GFLGLFTAGTYVCRAIVNGEEHESEEYIVHGWVGSSELHIDLKAEKKALLVGQTITVNCV
AKGSEMLEDHWKYPGKLAGRGVKTLKENKRDQEIHYTLTVPNATTKDSGIYTCSITDIMS
IESQTKELVIAVYEKEFVSVFPAFAPVETAKLDEVRDFRVDIVALPAPKITWLKDGVVLG
DVSAEIATSLRTINETRYQSTLTLIRAKGEDSGNYTVRAEIANQSASHSFSLQVKVPAVI
VDMMDLHHGSAAGQAAVCIAGGSPVPEVEWYICNNIKHCANDSSQWSPLQTNTTGITVDS
HIDQDNQLESQVIFGHLDNTLAVRCVARNDMAVVSREVKLVSNGPHSKLTVAAAVLVLLV
VVIISLIVLVIVWKQKPRYEIRWRVIESVSPDGHEYIYVDPMQLPYDSRWEFQRDGLVLG
RILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLN
IVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKAKKDLDIFGINPADES
SRSYVILSFEEKGDYMDMKQADTMQYVPMLERNEASKYLSLQRHDYDHPPSHTHTNESEV
EKLLSDDSEGLTTMDLLSFSFQVARGMEFLACKNCVHRDLAARNVLLSQGKIVKICDFGL
ARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGM
VVDSSFYNKIKSGYRMAKPEHASSNIYELMGKCWNNEPEKRPSFHSLSESVANLLPSGYK
RSYERVNSNFLKSDHPAVTRVQCVESDDSYLGVAYKNQGKMRERESGFDEQRLSSDSGYI
IPLPDLDPLSDEEYTKRNRHSSQTSEESAIETGSSSSTLPKREGETLEDITLLDEMCLDS
GDLVEDSFL
NT seq 4350 nt   +upstreamnt  +downstreamnt
atggggactgtgaagacacatctccttctgggggttgtcttactaggagtcctggaagtg
gtgtgtgatcttcctcctccgaccatcgtgtctaatgagacgcagttcgtgctgccgccg
cactccgtgtttaatatcagctgcacggggaagcagcgcgtgaagtgggaagagccgtta
ccgagaaacacgcacgtgctgccgggatattataccgccacgctgctcatagacgacgcc
gcggctttccacaccggaccttacacctgtgtttacgaggctgtggagacagagcccgcc
agcatctccatcttcgtacccgatcctgatgtcccatttgtgccagaggaacctaatgct
catgaagcagaagcttgggggtctctaatcccgtgtcgtgttacaaacccacggtccaac
gtgattctccggaccctgccaagtggagatgagatgccagccctatatgatgccagtcat
ggcttcttaggcaggttttctcctgggctctacgtctgtgagactgttgtgaatggcaag
gccgtccagagcgtggtgtactcagtagcagatgaccctgatgtaaaactgagagtcagt
cagcaggaagtgaaagagggagaagctttaaaccttacctgtgagacaccacccgggttt
cagtacctccagcagtggctgcatcccagcaaacaggctgcaggtgccgttcagatgaag
caggcatttcctgataaggtcgtgtacatcctcaatatcccacacgcttcagtggctgac
tctggattctacgagtgctctgtcactgatatttccagttcccgggcaaagtccgccagt
gtgaccgtcactgtccatgggacttcttttttggttctggatcacagtgggattggagca
gaagaaacgactcctctgttggaggaaaccgagtttaccttctacatcaaatctgacagc
gctccaaaggttacatggttcaaagatgaccaagagttgattagcaattttgcgaccacc
aagactgtactactagaagacaaaaggtatgagagtgtgttggtcctgcggcatccagtg
gaagaggacagcggaacatataagattgtagcatcagccggctcacagagtgcagagttc
tcctttaaacttcatgtaaaagcttctgagccagcgctgttgcagtctggtcttcctcca
ttaatctggcccaggaaggaggagatggtggtgtccctccattcctcattcagaataaca
tgtcggggtcaggaagagctgtcctggagtaccccaatccacatcgatgagccagtgagc
aaagacaaaaggggtctctacgtctccacattgaccatagacaatgcttcagcgatccat
acaggagaatatacctgctcgtacaacaatggaaaccagactgatgaggcctacatctac
atctatgtaccagatccagatgcgccattcgtgccctccctctttccttttattaaccat
gttctaaccaatcatgatggaatggaagttccttgcctagtctcagaccccagtgccaat
gtgactttgatcctcgtggagacccagcagccagtgcctgcccactatgacagcaagagg
ggctttttgggcctttttaccgctggaacgtatgtatgcagggccattgtgaacggtgag
gaacacgagagtgaggaatacattgtccacggctgggtaggaagttcagagttgcatatt
gatctgaaggccgagaagaaggctctgctggttggacagactattacagtcaactgtgta
gcaaaaggcagcgagatgttggaggatcactggaaatatcctggcaaactagctggtcgt
ggagtgaagacgttgaaggagaataagagagatcaggaaattcactacactctgactgtg
cctaatgccacaactaaagacagcggcatctacacctgctccatcactgatattatgagc
atcgagagccagactaaagagctcgtcattgctgtctatgaaaaggaatttgtgtctgtg
tttcctgcatttgcacctgtggagacggccaaactggatgaagtacgtgatttcagagtt
gacattgtggctcttcctgcccccaagatcacatggctgaaggacggcgttgtcctgggg
gacgtttccgcagagattgcaacctctctccggacaatcaatgagaccaggtatcagagc
actctgactctgattagagctaaaggcgaggacagcggtaactacacagtgagagctgag
atagccaatcagagtgctagccattccttcagcctgcaggttaaagtccctgcagtgatt
gtggatatgatggacctccaccacggctcagctgcaggtcaggcagcagtgtgtatcgcc
ggagggtctcccgtccctgaggtggagtggtacatctgtaataacatcaaacactgcgcc
aatgactcgagccagtggtcacctcttcagaccaacaccacagggatcacagtggattcg
cacatcgaccaggacaaccagctggaaagtcaggtgatcttcggacatctggacaacacg
ctggcggtccgctgtgtggcccgcaatgacatggctgtcgtctcccgggaggtcaagctg
gtgtccaatgggccacactcgaagctcaccgtggcagctgctgttctggtgctgttggtc
gttgtcatcatctcacttattgtgctggtcattgtctggaaacagaagccacgttatgag
atcagatggcgagtcattgagtctgtcagtccagatggacatgagtacatctatgtggac
cctatgcagctcccctatgactctcgctgggagttccaacgtgatggcctggttctgggc
cgtatcttgggttcgggtgcctttggaaaggtggttgagggcactgcatacggactgagt
cgctcacagccagtgatgaaggtggcagtgaagatgctaaaacctacagcccgctccagt
gagaagcaagcgctgatgtcagagctgaagatcatgactcacctgggccctcatctcaac
atcgtcaatctgttgggagcatgcaccaaatcaggtcccatctacataatcacggaatac
tgtttctatggagacctggtgaactatctgcataaaaacagggataacttcttgagccgc
caccctgaaaaggccaagaaggatctggacatctttggtatcaacccagctgatgagagc
agccggagctacgtgatcctgtcttttgaggagaagggagactatatggatatgaagcag
gcagacaccatgcagtatgttcccatgctggaaaggaacgaagcttccaaatacttaagc
cttcagagacacgactacgatcaccctccctctcacacacacaccaatgagagtgaggtg
gagaagcttctgtctgacgactcagaggggctgaccaccatggatcttctcagcttctcc
tttcaagtggccagaggaatggagtttctggcctgcaagaattgtgtgcacagagatttg
gcagcccggaatgtcctgctgtctcagggtaagattgtgaagatctgtgactttgggctg
gccagagacatcatgcacgataacaactacgtgtccaaaggaagcacctttctaccagtg
aaatggatggcccctgagagcatcttcgataacctgtacaccaccctgagtgatgtgtgg
tcttacgggatattactatgggagatcttctctctgggaggaactccttatcctggtatg
gttgtggactccagcttctataacaagatcaagagtggatacaggatggcaaagcctgaa
cacgcctccagtaatatatatgagctgatggggaagtgctggaacaatgagcctgagaag
agaccctccttccacagcctgagtgagagtgtggccaacctgctgccctctggatacaag
agaagctacgagcgcgtcaacagtaacttcctaaagagtgaccacccagcggtgacacgc
gtgcagtgtgtggagagtgatgattcctacttgggtgtggcctataaaaaccagggcaag
atgagggagcgcgagagcggctttgacgaacagaggctgagctcagacagtggatacatc
atccctctgcctgacctcgacccgttgtccgacgaggagtacacaaagaggaatcgccac
agctcccagacctcagaggagagcgctatagagacgggctcgagcagctccactctacca
aagcgggagggtgagactttggaggacatcacgctgctggatgagatgtgcctggactcg
ggggatctggtggaggacagcttcctgtga

DBGET integrated database retrieval system