KEGG   Astyanax mexicanus (Mexican tetra): 103044858
Entry
103044858         CDS       T05042                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04010  MAPK signaling pathway
amex04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103044858
   04012 ErbB signaling pathway
    103044858
SSDB
Motif
Pfam: Laminin_EGF SSP160
Other DBs
NCBI-GeneID: 103044858
NCBI-ProteinID: XP_007254397
Ensembl: ENSAMXG00000002277
LinkDB
Position
13
AA seq 186 aa
MYRAFWDTIFLLIGSLFTYGQVQENSTSTTSTPTTPTPTSSTTTATTISTTTVASTTKAV
RKFIAAAVHSHFADCPDSHSQFCFHGTCRFLILEETPACVCHPGFMGMRCEHADLLAVVA
TNHRQQTVATMLVLCVVGSVLLMLLCTLLNCWWRRGGCRQGLSCWSEKPSTIIKGGSSCC
HSETVV
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtatcgagcgttttgggacacgatattcctcctgattggctccttgtttacatatggg
caggtgcaggaaaattcaacctcaacaacctcaactccaacaactccaactccaacaagc
agcaccaccacagcaaccaccatcagcaccaccactgtggcaagtactactaaagctgtc
agaaagtttatagcagcagcagtccactcgcactttgcagactgccctgactcccacagc
caattctgcttccacggcacatgccgcttcctcatcctggaggagacgcctgcgtgtgtg
tgtcacccaggatttatggggatgcgatgtgaacatgcagacctgttggcggtggtggcg
accaaccacaggcaacagacagtggctaccatgctagttctgtgtgtagtgggcagtgtc
ctgctcatgctgctttgcacactattaaattgttggtggaggagaggagggtgtagacaa
ggtctttcctgttggtcggaaaaaccaagtaccatcataaagggaggatcatcctgctgc
cactcagagacagtggtttga

DBGET integrated database retrieval system