KEGG   Astyanax mexicanus (Mexican tetra): 103045130Help
Entry
103045130         CDS       T05042                                 

Gene name
rnpep
Definition
(RefSeq) aminopeptidase B isoform X1
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amex01002]
    103045130 (rnpep)
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     103045130 (rnpep)
Peptidases and inhibitors [BR:amex01002]
 Metallo peptidases
  Family M1
   103045130 (rnpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 103045130
NCBI-ProteinID: XP_007248482
Ensembl: ENSAMXG00000024736
LinkDB All DBs
Position
22
AA seq 625 aa AA seqDB search
MDDKAAVLHADTAEDVATSSSFRRFRIEHFHLDLQVDFDQRSLSGTESLRVRCALGSAAE
LLLDSHPSLELHEVSFSRDERDWTAAQFHSRDFTSYGSTLVVQFPTAWSSGDQFHLSIKY
TAHQGPGVCWLDPEQTAGKLRPYVFTQGQAVLNRSFFPCFDTPAVKSTYTAAIKVPDGFT
AVMSATKWEHRKADNTFLFSMEQPIPAYLVALAVGDLVSAEVGPRSRVWTEPCLLEAAKK
EYDGVIEEFLLVGERLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLAD
VIIHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRICKELYGEAYTCLEAATGRALLRQ
HMDNTGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLRGDQKRFDAFLKAY
VDRFKFRSVIAEDALEFFLEFFPDLKKNSVHKIEGLEFDSWLNVSGWPLYLPDLSAGQSL
MKPADQLADLWGADSVDIAAISKINTEAWKTYQTVYFLDKIIEKSPLPDGNTRMLEEQYP
HMVKSNNAELRLRWAQIVAKNQHKPGYPHVRSFLSCQGKQKYTLPVYRALWSGTEEMKAL
ATEIFSATSHQLHINVRNYVKKIMV
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggatgataaagccgcggttctgcacgcggacacggcggaggacgtggcaacctcctcc
agtttccgacggttccgaatagagcacttccacctggacctgcaggtggacttcgaccag
aggagcctctccggaaccgagtctctgcgggtccgctgcgcgctgggctccgccgccgag
ctgctcctggactcccaccccagcctggagctgcacgaggtctccttcagccgggacgag
cgggactggaccgctgcccagttccacagccgtgacttcaccagctacgggtccacgctg
gtggtccagttccccaccgcctggagctcaggagaccagttccacctttccatcaaatac
acagcccaccagggacccggggtatgctggctggacccggagcagacggctgggaagctc
cggccgtacgtgttcactcagggccaggccgtcctcaaccggtcattcttcccctgcttc
gacactccagccgtaaagagcacatacaccgccgccatcaaggtgcctgatggctttact
gcagttatgagtgccaccaagtgggagcacaggaaagcagataacaccttcctcttcagc
atggagcagcccatacctgcctacctggtggcactggcagtcggggacctggtatcagct
gaagtgggtccaaggtcacgggtgtggacagagccgtgcttattggaagctgccaagaaa
gagtacgatggtgtgatcgaggagtttcttctggtaggagagaggctgtttgggccatac
gtttggggaaggtatgatgtgctgttcatgccaccgtcattcccattcggcgggatggag
aacccctgcctgaccttcgtcactccgtgcctgctggcgggtgaccgatcactcgctgac
gtcatcatccatgagatctgccacagctggttcggaaacctcgtcaccaacgccaattgg
ggggatttctggcttaacgagggcttcaccatgtacgcccagcgcagaatctgtaaagaa
ctgtacggcgaggcgtatacctgtctggaagcagctacaggccgagcgttactcagacag
cacatggacaacaccggagaagaccatcctctcaacaaactgcgggtcaagatcaaaccg
ggtgttgatcctgacgacacatataacgagacaccgtacgagaaaggcttctgcttcgta
tcatatctggcccacctgagaggagaccagaaacgcttcgatgcttttctcaaggcgtat
gtggacaggtttaagttccgcagtgtgatcgctgaggatgctctggagttcttcctggag
tttttccctgacctgaagaagaacagcgtccacaagattgaaggtttggagtttgatagc
tggctgaacgtttctggatggcctctgtacctcccggacctctctgccggacagagcctg
atgaagcctgctgaccagctggctgacctctggggggcggacagcgtcgacatcgccgcc
atcagcaagatcaatacagaagcctggaagacctaccaaactgtttacttcctggacaag
ataattgagaagtctccacttcctgatggtaataccagaatgctagaagaacagtaccca
cacatggtgaagtccaataacgctgagttaagactacgctgggcccagattgttgcgaag
aaccaacacaaacctggatacccacacgttcgcagtttcctcagctgtcaggggaaacag
aagtacacgttaccagtgtatcgggctctgtggagcggaacagaggagatgaaggctttg
gctacagagatcttctctgctacttcccatcagctccacataaacgtccgaaattacgtg
aagaagataatggtctga

DBGET integrated database retrieval system