KEGG   Astyanax mexicanus (Mexican tetra): 103045624Help
Entry
103045624         CDS       T05042                                 

Gene name
mapk6
Definition
(RefSeq) mitogen-activated protein kinase 6
  KO
K06855  mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103045624 (mapk6)
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103045624 (mapk6)
Protein kinases [BR:amex01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103045624 (mapk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 103045624
NCBI-ProteinID: XP_007242383
Ensembl: ENSAMXG00000010413
UniProt: W5KSY2
LinkDB All DBs
Position
18
AA seq 731 aa AA seqDB search
MAEKFESLMNIHGFDLGPRYMDLKPLGYGGNGLVFSAVDTDCDKRVAVKKIILTDPQSVK
HALREIKIIRRLDHDNIVKVFETLGPSGRRLTEDVTSLTEVNSVYIVQEYMETDLCKVLE
QGLLSEGHARLFMYQLLRGLKYIHSANVLHRDLKPANLFVNTEDLVLKIGDFGLARIMDP
HYSHKGHLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQ
MQLILESIPVIHEEDRQELQSVIPVFIKNDMSVPHTPLAKLMPGVSAEALDFLEKILTFN
PMDRLTAEEALAHPYMSDYSFPLDEPVSSHPFHIEDEVDDILLMDESHSHVYNWDRYHDS
QLSEPDWHLHSTAEAEDVQRDPRALSDVTDDEEVQVDPRKYADADSEKFLDDPAAFDFPP
DRSWPQYDDHHENKYCDLECSHTCNYKAVSPSYLDNLIWRESEVNHYYEPKLIIDLSNWK
EQQSKEKGDKKSKSKCEKNGLVKAQIALQEAGHNHHGISQSPPEKDRQQEKHQNQSQGFD
FDSFIAGTIKLSLQPEPSQVGLLNELNTSVSQLSKSVSQEKDEKCQVNLAQQGGRPPCPW
DSYGSPGAEESSCMIDQACWDAQKDGGLGSGGGYTSYLDRLFSKREESTMITPPESSEDF
SPDSDVPLTTPQEETAPGFLARNGEIVLESLAIPGDLPLKSLQATLTPAAHVKCSPQIAH
KTYSSIFKHLN
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagtttgaaagcctcatgaacattcacgggttcgacctgggccctcggtac
atggacttgaagccgctgggctatgggggtaacggcctggtgttttccgctgtggacaca
gactgcgacaagcgggtggccgtcaagaaaatcatcctgacagaccctcagagtgtgaag
catgcgctccgcgagatcaagatcatccggcggctcgaccatgacaacatcgtcaaggtg
tttgagacactaggccccagcggacggcggctgacggaggacgtgacctcgctgaccgag
gtcaactccgtctacatcgtacaggagtacatggagacggacctgtgcaaggtgctggag
cagggtctgctctccgagggccacgcccgcctcttcatgtaccagctgctccgcggcctc
aagtacatccactctgccaatgtcctgcaccgagacctcaaacctgccaacctgttcgtc
aacactgaggacctcgtgcttaaaattggagacttcggcttggcccgcatcatggaccca
cactactcgcacaagggtcacctgtcagaaggtctggtcaccaagtggtatcgctcccca
cgtctactcctctccccaaacaactacactaaagccatcgatatgtgggctgctggctgc
atctttgcagaaatgctcaccggaaaaacactctttgcaggagcccatgagctggagcag
atgcagttaatactagagtcaattcctgtgatccatgaagaggaccggcaggagctacag
agcgttatccccgttttcatcaagaacgacatgtccgtaccacacacacccctcgccaag
ctgatgccaggggtcagcgctgaggctctggatttcctggagaagatcctgaccttcaac
cccatggaccggttgacagcagaggaggccctggcgcacccctacatgagcgactactca
tttcctctggacgagccggtgtcctcgcaccctttccacatcgaggacgaggtggacgac
atcctgctcatggacgagagccacagccacgtctacaactgggacaggtaccacgacagc
cagctttccgagccagactggcacctccacagcacagcagaggctgaggacgtacagcgc
gaccctcgtgccctctcggacgtcacagacgacgaagaggtgcaggtagacccgcgcaag
tacgccgacgccgacagcgagaagttcctagacgacccagctgccttcgacttccctccg
gaccgctcgtggccgcagtacgacgaccatcacgagaacaagtactgtgacttggagtgc
agccatacctgtaactacaaggctgtttctccctcctacctggacaacctaatctggcgg
gagagtgaggtcaaccactattacgagcccaagctgatcatagatctgtccaactggaag
gagcagcagagcaaagagaaaggagacaagaagagcaagagcaagtgcgagaagaacggc
ctggtgaaggctcagatcgctctgcaggaggccggtcacaaccaccacggcatcagccag
agtcccccagagaaagaccgccagcaggagaaacaccagaaccagagtcagggctttgat
ttcgactccttcatagcaggcaccattaagctaagccttcagcccgaacccagccaggtg
ggcctgctgaacgagctcaacacctccgtgtcccagctgtccaagtccgtcagccaggag
aaggacgagaagtgccaggtgaacctggcgcagcagggcggccgcccgccgtgcccgtgg
gacagctacggaagcccgggggcagaggagagcagctgcatgatcgatcaggcctgctgg
gatgcccagaaagacggtggtctcggaagcggcggaggatacaccagctacctggaccga
ctcttcagcaaacgggaagaaagcaccatgatcacacctccagaatcatccgaagacttc
tcccccgactcggacgtccccctcaccaccccccaggaggaaaccgcgcccgggttcctc
gcccgaaacggagaaatcgtcctggagtcgctggccatccccggcgacctgccgctgaag
tccttgcaggccacgctgacgccggcggcccacgtcaagtgctcccctcagatcgcccac
aagacctacagcagcatttttaaacatctgaattaa

DBGET integrated database retrieval system