KEGG   Astyanax mexicanus (Mexican tetra): 103046993Help
Entry
103046993         CDS       T05042                                 

Definition
(RefSeq) tyrosine-protein kinase Lyn-like
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:amex01001]
    103046993
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amex04131]
    103046993
Enzymes [BR:amex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103046993
Protein kinases [BR:amex01001]
 Non-receptor tyrosine kinases
  SRC family
   103046993
Membrane trafficking [BR:amex04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103046993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103046993
NCBI-ProteinID: XP_022533366
Ensembl: ENSAMXG00000002788 ENSAMXG00000017492
LinkDB All DBs
Position
16
AA seq 507 aa AA seqDB search
MGCGKSKGKKSSVEQRQRTPQNDRYTRDPTQPGSNAKNLPLLPGQTLQRADDTTDTSNKE
IVAVAKFAYEAVNASQLTFRKGERFRILEKNSDWWKAKSLTSGKEGIIPSNYVEEEESLD
TNEWFFKNTNRKDAERILLAPANKPGAFLIRKSETTEGCFSMTVRDVNDSGASVVKHYKI
RTLDDGGFYISPRITFKKMDELIKHYQKQPDGLCRRIGKACVKPKGEIQWDEDAWEISKE
SIRMVKRLGAGQFGEVWLALYNNNTKVAVKTLKPGTMSVDAFLQEANLMKNLRHDHLVRL
LAVITKTEPIFIITEFMANGSLLDFLKSPPGRRIQLPKQIDFGAQIAEGMAYIEKKNYIH
RDLRAANILVSETLLCKVADFGLARVIEENEYSASEGAKFPIKWTAPEAINYGSFTIKSD
MWSFGILLYEIITHGKIPYTGLNNAEVMARVQRGYRIPQPELCPSKLYEIMTTCWKSSPE
ERPTFDYMQSILEDYFTATEDQYQQQP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtgggaaatctaaaggaaaaaaaagctcagttgaacaaaggcagcgcacacct
cagaatgacagatacaccagagacccaactcagccaggatcaaatgcgaagaatttacct
ctactgcccggacagactctgcaaagggccgatgacaccacagacaccagcaacaaagag
atagttgcggttgctaagtttgcatatgaagctgttaacgcatctcagctgactttcaga
aaaggagagaggttccgaatattggaaaagaatagtgactggtggaaagctaagtccttg
acatctggcaaagaaggcattattccttccaattatgtggaggaagaagaaagcctagac
acaaatgaatggttctttaaaaacaccaacagaaaagatgcagaaagaatccttttggct
cctgctaataaacctggagccttcctaattcgaaagagtgagactactgaagggtgtttt
tctatgactgtgagggatgtgaatgatagcggtgcatcggtggtgaagcattataagatt
cgtacgttagatgatggaggattttacatctccccaagaatcaccttcaaaaaaatggac
gaactcatcaagcactaccagaagcagccagatggactatgcaggcgaataggcaaagct
tgtgtgaagccaaaaggtgaaattcagtgggatgaagatgcgtgggagatttcaaaagaa
agtattcgtatggtcaagagacttggagctgggcagtttggagaagtctggttagcgttg
tataacaacaataccaaggtggcagtgaagactctgaagcctggcactatgtcagttgat
gcatttctgcaggaggctaacctgatgaaaaatcttcgtcatgatcatctggtccgcctc
ttggccgtaataaccaaaacagaacccatcttcatcatcacagagttcatggctaatggt
agcttgttggattttctgaagagtccaccaggcagaaggatacagctgcccaaacagata
gacttcggtgctcagattgcagaaggcatggcctacatagagaagaagaactacattcac
agagacctgcgggctgctaacattctagtgagtgagacgctgctgtgtaaggttgctgac
ttcggcctggccagggtcattgaagaaaatgagtactcagccagtgaaggtgccaaattc
cccattaagtggacggcaccagaggctataaactacggttctttcaccattaagtcagat
atgtggtcttttggcatcctgctgtatgagatcatcactcatgggaaaatcccctacaca
ggtttgaacaatgctgaagtgatggcgagggttcagcggggctaccggataccacagcct
gaactctgccccagcaagctatatgagatcatgactacatgctggaaaagtagcccagag
gaacggcccacctttgactacatgcagagcatcctggaggattacttcactgctactgag
gaccaatatcagcaacagccatga

DBGET integrated database retrieval system