KEGG   Astyanax mexicanus (Mexican tetra): 103047217
Entry
103047217         CDS       T05042                                 

Gene name
cdkn1a
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04012  ErbB signaling pathway
amex04068  FoxO signaling pathway
amex04110  Cell cycle
amex04115  p53 signaling pathway
amex04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103047217 (cdkn1a)
   04068 FoxO signaling pathway
    103047217 (cdkn1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103047217 (cdkn1a)
   04115 p53 signaling pathway
    103047217 (cdkn1a)
   04218 Cellular senescence
    103047217 (cdkn1a)
SSDB
Motif
Pfam: CDI SR-25 WDCP ORC6
Other DBs
NCBI-GeneID: 103047217
NCBI-ProteinID: XP_007256770
Ensembl: ENSAMXG00000008834
LinkDB
Position
22
AA seq 174 aa
MCRIMSFHKRVLRSLGNGPARRSLFGPVDREQLQAEYRDALRKDVEDASRRWGFDFASEK
PLDGGDFQWEGVPGARVPALYRACTVGEELRPQTAESISASSTSASASSTPSSSFCSAAG
KENVPKTPERYASLQQNLENTPEKQNSLKRKQTNITDFYQAKRRVVATPRKSGQ
NT seq 525 nt   +upstreamnt  +downstreamnt
atgtgcagaataatgtccttccataagcgagttctgcgctctctggggaacggtcccgcc
cgcaggagtctgtttgggccggtggatcgggagcagctgcaggcggagtatcgagatgct
ctgaggaaggatgtagaggacgcgtcccgccgatgggggttcgacttcgcctctgagaag
cccctggacgggggagactttcagtgggagggggtcccaggggcccgggtccccgccctg
taccgggcctgcactgtgggagaagaactgcgaccacagacggcggaatccatttcagct
tcatccacctcagcttcagcttcatccacaccatcgagttcgttctgctctgcggctgga
aaagagaacgttcccaaaacaccagagagatacgccagcctccagcagaacctggagaac
acgcccgagaaacagaacagcctgaagaggaaacagaccaacattacagatttctatcag
gccaagagacgagtcgtagccactcccagaaaatcaggccaatga

DBGET integrated database retrieval system