KEGG   Astyanax mexicanus (Mexican tetra): 103047440Help
Entry
103047440         CDS       T05042                                 

Definition
(RefSeq) transmembrane protease serine 4-like isoform X2
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    103047440
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103047440
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103047440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 SRCR DUF1986 Ldl_recept_a Hepsin-SRCR DUF5467
Motif
Other DBs
NCBI-GeneID: 103047440
NCBI-ProteinID: XP_007239141
Ensembl: ENSAMXG00000004226
UniProt: W5K9Q4
LinkDB All DBs
Position
Unknown
AA seq 456 aa AA seqDB search
MRTNTQVSEESQRPLNPKPQVVARPGRHRKPMSAAQPPRSKGASHRKIILTILCVLVILA
ILAVAAYFIQQLIQSKFFFCSQSLKFIPLEQACDGKSDCSGAEDEATCLSHFSSNYTFPV
RLSSNLSVLQIYSASDRKWGSVCADGWTQQHTQTACEQLGYTVNPSHRTIVMNDLPSDLK
ASYFAIGSGSVQVMQSSFSDKKTCSLGSVVALSCSDCGPPAPASRIVGGHDALIENWPWQ
VSLQQNGQHTCGGSLLSPKWVLTAAHCFTSRGEVSRWRVVAGKTYLSSLGGSSVEKIIVN
ADYVAARNDYDLAMMKLSSPLSVGASVKPVCLPPRNLGLTGGAPLVVTGWGHLQENGQLS
SNLQKADILLIDQARCSSPVVYGASITSRMFCAGYLEGKVDACQGDSGGPLVYYGRRWML
VGVVSWGVGCAREDRPGVYSNVEQMMNWVYTVMEKS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaggactaatacccaggtttctgaagaaagccaaagacccttaaacccaaaacctcaa
gttgtggccaggcctggcaggcacaggaagcccatgtctgctgcacagcctccgaggagc
aaaggggcatcgcacagaaagatcatcctcaccatcctctgtgttctggtcattctggct
attctggctgtggctgcatacttcatccaacagctcattcaaagcaagtttttcttctgc
tcccaatcactgaagttcatcccactggagcaagcctgtgatggtaaatcagactgctca
ggagccgaagatgaggccacgtgtttgtcccacttttcgtccaactatactttccctgtt
cgactctcctccaatctctcggtgcttcagatatacagtgccagtgacaggaagtggggg
agtgtgtgtgcagacggctggacccagcaacacactcagacagcatgtgaacagctagga
tacactgttaatccttctcaccgcaccatcgtaatgaatgatctgccgtctgacctgaag
gcttcttacttcgccattgggtcgggcagtgtgcaggtcatgcagtcaagtttctcagac
aaaaagacatgcagtctgggttcagtagttgccctgtcctgctcagattgtggtcctccg
gctcctgcgagccgcatcgtaggagggcatgatgcactgattgagaactggccgtggcag
gtgagcctgcagcagaacgggcagcacacctgtggaggctccttgctgtccccaaaatgg
gtcctcacagcagcccactgcttcaccagtaggggtgaggtgagcaggtggcgggtggtg
gcaggtaaaacatacctgagctctctgggaggatctagtgtggaaaagattatagtaaat
gcagactacgttgcagcacgcaacgactacgacctggccatgatgaagctcagcagccca
ctcagtgttggagcttctgtgaagccagtgtgtctgccgcctcggaacctgggcctgact
ggaggagctcctctggtggtgactggctggggtcatctgcaggaaaatgggcagttatct
tctaatctacagaaagcagatattctcctcatagaccaggcgcgttgttccagtcctgta
gtttatggtgccagcatcacctccaggatgttctgtgctgggtacctggaaggcaaagtg
gacgcatgccagggggacagtggtggtccattggtgtattatggcaggcgctggatgctg
gttggggtggtcagctggggcgtgggctgtgccagagaggaccggcctggtgtttacagt
aatgtggaacagatgatgaactgggtatacacagtcatggagaagtcctga

DBGET integrated database retrieval system