Astyanax mexicanus (Mexican tetra): 111188379 Help Entry 111188379         CDS       T05042                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:amex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111188379  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amex04121]     111188379    03400 DNA repair and recombination proteins [BR:amex03400]     111188379 Ubiquitin system [BR:amex04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      111188379    Cul5 complex      111188379 DNA repair and recombination proteins [BR:amex03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      111188379 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  111188379 NCBI-ProteinID:  XP_022517784 LinkDB All DBs Position Unknown AA seq 131 aa AA seqDB search KDLIILSFSLFSQDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEEQRLYKDD MLLEDSKTLGDCGFTNQTARPQAPATVGLAFRVSDDAFEPLRVEPFSSPPELPDVMKPQD SGSTANEQAVQ NT seq 396 nt NT seq  +upstreamnt  +downstreamnt aaagatttaatcatcctgtcattctctttattctctcaggatgtgtttttgatgatcaga cgtcacaagacgaccatcttcacagatgctaaggagtctactacagtctatgaactcaaa cgtattgtggaaggcatcctgaagcgaccgcctgaggaacagagactttacaaggatgac atgttgctagaagacagcaagactcttggagactgtggattcacaaaccagacagcaaga ccccaggctccagccacagtaggactggcctttcgcgtcagcgatgatgcatttgagcct ctgagagtggaaccgttctccagtcctcctgaactgcccgatgtgatgaagccccaggac tccggcagcactgccaacgagcaggcggtgcagtga

DBGET integrated database retrieval system