KEGG   Astyanax mexicanus (Mexican tetra): 111191999Help
Entry
111191999         CDS       T05042                                 

Gene name
ppp1r7
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 7
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
amex  Astyanax mexicanus (Mexican tetra)
Brite
KEGG Orthology (KO) [BR:amex00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amex01009]
    111191999 (ppp1r7)
Protein phosphatases and associated proteins [BR:amex01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111191999 (ppp1r7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_9 LRR_8
Motif
Other DBs
NCBI-GeneID: 111191999
NCBI-ProteinID: XP_022524099
LinkDB All DBs
Position
Unknown
AA seq 346 aa AA seqDB search
MASLSSSEPQEMEVDRRGESEESGDDETKRKSLNGEVELDSQQASTVPEESPVDMDTITL
DPNEEDVDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRK
LENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELG
SNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNL
RELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDL
DELKNAKGLETVYLERNPLQKDPQYRRKIMLALPSVRQIDATFIRF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtctgtccagcagcgagccgcaggagatggaagttgacaggcgaggtgaatct
gaagagtcaggagatgacgagaccaagaggaagagtcttaatggagaggtggagctcgat
tcccaacaggcctccacagtcccagaggagtcgcctgttgatatggacaccataaccctc
gaccctaatgaagaggatgtggatctggtgcactgtcggattgggaagattgaagggctg
gaagttttgcagaaagccaagactctttctctcagacaaaacctgattaagaagattgag
aacctggagagcctgtcgtctctgcgggaactcgacctgtacgacaaccagatccgcaaa
ctggagaacctacaggccctgactgagctggagcagctagacgtatcgtttaacctcctg
aggaagatcgaggggttggagagattaacgaaggtgaagaagctcttcctgctgcacaat
aagataagcagcatcgctaacctagaacacctcacaagccttcacatgctggagctgggg
tccaatcgcatcaggatcatcgagaatctagacgctcttacctcattggatagtttgttt
cttggcacgaataaaatcacgaagctacagaatctggatggtctgcacaatctgacggtc
ctcagtattcagagtaatcgtatcacaaagctggagggtctccagaacatggtgaacctg
agggaactctacctgagccacaacggcatcgaggtcatcgagggtctggagaacaacaaa
aagctgacgaccctggacatcgcggccaacaggataaagaaaatcgaaaacataagtcac
ctaacagatctgcaggaattctggatgaacgacaaccagatagagaactggagcgacctg
gacgagctgaagaacgccaaaggtttagagacggtgtatctggagcggaaccccctgcag
aaggaccctcagtacaggcgcaagatcatgctggcgctgcccagcgtccggcagatcgac
gccaccttcatccgcttctga

DBGET integrated database retrieval system