KEGG   Astyanax mexicanus (Mexican tetra): 111193439Help
Entry
111193439         CDS       T05042                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
amex  Astyanax mexicanus (Mexican tetra)
Pathway
amex04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:amex00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111193439
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amex01002]
    111193439
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amex04147]
    111193439
Enzymes [BR:amex01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     111193439
Peptidases [BR:amex01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   111193439
Exosome [BR:amex04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111193439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 111193439
NCBI-ProteinID: XP_022529984
LinkDB All DBs
Position
11
AA seq 265 aa AA seqDB search
MVYLPVLFQFGLSPVVMRCIVAVLLLVAVACSRADDDKIIGGYECRPHSQPWQIYLTYDD
GERWCGASLINERWAVSAAHCYVPAHRLALHLGEHHIFEDEGTEQRIWAEKVIPYPAYDD
YTYDHDFMLIKLSQPAVFNQYVQPIPLATTCARDGEQCLVSGWGNQITTGVNYASVLQCL
DLPVVSRSDCEAAYPNQITKNMFCAGFLEGGKDSCQGDSGGPLVCNGQLQGVVSWGYYCA
APGYPGVYAEVCRYTDWIKNTIANN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggtctatcttccagttctatttcagtttggtctttctccagtagtaatgaggtgtatt
gtagcggtgttgctgctggtggctgtggcatgcagcagagctgatgatgataagatcatc
ggcgggtacgagtgtcgacctcactctcagccctggcagatttatctaacctacgatgat
ggtgagcgctggtgtggtgcttctttgatcaatgagagatgggcagtgtcggcagcgcac
tgttacgtcccggcccatcgtctcgctctgcacctgggagagcaccacatcttcgaagac
gagggcacagagcagaggatctgggcagagaaggtcataccctatcccgcctacgacgat
tacacctacgaccacgacttcatgctgatcaagctgagccagcctgctgttttcaatcag
tacgtgcagccgattcctctggccaccacatgtgcaagagatggggagcagtgcttggtg
tctggatggggtaatcagatcaccactggagtgaactatgcgtctgtactgcagtgcctg
gatttacccgtggtctcacgctcagactgtgaagctgcttatccaaaccagatcactaag
aacatgttctgcgctggattcctggagggaggcaaagattcatgccagggagactccggt
ggtcctctggtgtgtaacgggcagctgcagggcgtcgtgtcctgggggtattactgtgct
gctcctggttatcctggtgtttatgctgaagtctgtcgctacactgactggatcaaaaac
accattgccaacaattaa

DBGET integrated database retrieval system