KEGG   Alteromonas macleodii English Channel 673: AMEC673_04030Help
Entry
AMEC673_04030     CDS       T02254                                 

Definition
(GenBank) exonuclease SbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
amg  Alteromonas macleodii English Channel 673
Brite
KEGG Orthology (KO) [BR:amg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:amg03400]
    AMEC673_04030
DNA repair and recombination proteins [BR:amg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AMEC673_04030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C AAA_29 AAA_21 NTPase_1 AAA_25 SMC_N Ribosomal_L17 AAA_22 DUF3854
Motif
Other DBs
NCBI-ProteinID: AFT73503
LinkDB All DBs
Position
933412..937149
Genome map
AA seq 1245 aa AA seqDB search
MRILTLRLKNLNALKGEWKIDFTHSPFIDNGLFAITGPTGAGKTTLLDAICLALYHQTPR
LGPISTSNNDIMTRGTAECLAEVEFDIKGKAYRAFWSMRRARGKVDGNLQSADVELAEVE
SGEVLATQVRPKSEEIEKLTGLNFARFTKSMMLSQGDFAAFLNANEADRAELLEELTGTE
IYGQISQAVHQQFSDAKQKKKEFAIKLDGVTLLSDEQITQLEEEQAQTKSQVAAFNQTLV
ELQKQQQWQHAFNANELAIKEASEAQQSANNAINEAKQKLDLLAQSEPAEKLRLPFLQRN
GLQQDVTRYKERLEEKAAQLPDLKSQKAQLSLEVTNAEQALALTKQQSSELEKRINEQVI
PLDNQIAQLTTEQQKANENKARLRQSINALTLKRTEIENASADNKTKLGELEAYLSEHHT
LSGIAEFISGWSETARHIEHDKKQLETLTQSVNNHRQALSSLDDAIAKTNESLSALRQTF
DDKNAQVAKCEKALQAALSDKPSDTNSANATSKASLQQERDTKLHHWDNVLQIGHIQQQY
LALEQEKVSLGAQKEDLAKQLAQQQSDRQALVDAYKQTRSNLKDIEALIALDAEVAHLRA
RLKSGEPCPVCGANEHTTSSVVIDVPETIQKRDSLKQQLDDIEQQGARAKESVTHTEFTL
AQVNKKLEQASGQRDTLLEKWQQISSVLSADIPSFEKIDINTSQSVAQFTQQFKTRLDDI
SAQLTRLEECEQALNAALQAKNEAQQLLQAKQSELAVSLQQRETFEKQFNERNVELENKT
QGINNSILALSETMTAHGADIHNLAIDGIATWLNEKAEALKTYKHNHQLHAKLKDELQGV
SSALLVVNRDIESAENQLKDVSEELVQLDNSLKALRDSRTTVFPEGNIAETRNKANAAQE
MAERNVNECKSRLQQTDTILSRLEAEIAQLNEQMREKEQALTEATEHFSRQLASSPFDDE
QAFSNALLDEDTRNTLLELQKRLAQQKQQADLKLENALATQQSLKAHANAAQWQSELEEH
GAQWLDTKITQQAQQRDTLLSSLGQIEQQLSANNQARERQQQLVDEMAAFEAYYDDITYL
HSLIGSASGDKFRRFAQGLTLDNLVQLANQQLDKLHGRYQLIRKENEGLGLSVLDTWQGD
VVRDTKTLSGGESFLVSLALALALSDLVSHKTSIDSLFLDEGFGTLDAETLDVALDALDN
LNASGKMIGVISHIEAMKERIPTQLKVIKRNGVGLSALEKPYAVG
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgagaatattgaccttacgccttaaaaacttaaacgccctaaaaggggagtggaagata
gatttcacccattcgccgtttatcgacaatggcctttttgccataactggcccaacaggg
gcaggtaaaaccacgctacttgatgctatttgtttagcgctttatcaccaaacccctcgc
ttgggaccaatttcaacgtctaacaacgacatcatgacccgcggcacggcggagtgtttg
gcggaggttgagtttgatattaagggaaaagcataccgtgcgttttggagtatgcgtcgg
gccagagggaaagttgacggtaacctgcaaagtgctgatgttgagctggccgaagttgaa
agcggcgaggtattggctacccaagttaggccgaaaagcgaagagattgaaaagctgact
ggccttaattttgcccgtttcaccaagtctatgatgttgtcgcaaggggattttgctgcg
tttttaaatgctaacgaggccgaccgagccgaactgcttgaagagttaactggcaccgaa
atttacgggcagatatcacaggcagtacatcagcaatttagtgacgctaaacaaaagaaa
aaagagtttgcgataaagctagacggcgtaaccttacttagcgacgaacaaatcacccag
cttgaagaagagcaagcacaaaccaagagccaagtcgccgcgtttaatcaaacactcgtt
gagctacaaaagcaacagcagtggcaacatgcgtttaacgctaacgaactcgccattaaa
gaagccagtgaagcacagcagagcgcgaataacgccatcaatgaggcgaaacaaaaactt
gatcttctcgctcaaagtgagccagctgaaaagcttcgcctgccatttttgcaaagaaac
gggcttcagcaagacgtaacccgttataaagaaaggcttgaagagaaagcagctcagttg
ccagacttaaaatcgcaaaaggcacagctcagtttggaagtgaccaacgctgaacaagcg
ctagcgcttacaaagcaacaaagcagtgagcttgaaaagcgcataaatgagcaggtgatt
ccgttagataaccaaatagcgcagctcactactgaacagcaaaaagcaaacgaaaacaag
gcacgtttaaggcagtcaataaacgcgttaacgctaaagcgcacagaaatcgaaaacgct
tcggcagataacaaaacaaagctaggtgaactggaagcttacttgagtgaacaccacaca
cttagcggcatagcggaatttataagtggttggagtgaaacggcgcgccatattgaacat
gataaaaagcagttagaaacactgacacaaagcgtaaataatcatcgtcaggcgctttca
tccctagatgacgctatcgcaaaaacaaatgagtcgttaagcgcgttaaggcagaccttc
gatgacaaaaacgcgcaagtagccaagtgcgaaaaggcacttcaggccgcgctatctgac
aaaccaagtgatactaatagtgctaatgcaaccagtaaagcaagtcttcagcaagagcgt
gataccaagcttcatcattgggataacgtattacagatagggcatattcaacagcaatat
ttggcactagaacaagagaaagtatcgctgggtgcgcaaaaggaagacttagcgaagcaa
ctagctcagcagcaatctgaccgccaagccttggttgatgcttacaagcaaactcgtagt
aatttaaaagacatagaggcgcttatcgccctggatgctgaagtggcgcaccttcgcgca
cggttaaaaagtggcgagccatgccctgtttgtggagctaacgaacacaccacgtctagc
gtggttattgatgtacctgaaactatccaaaagcgagatagtttaaagcagcagttagat
gatattgagcagcaaggggcgcgggcaaaagaaagcgttacacacactgaattcactctt
gctcaggttaataagaagctagaacaggcaagcgggcaacgagatacgctgctagaaaag
tggcagcagatttcaagcgtacttagtgctgatataccgagctttgaaaagatcgacatt
aatacttcgcaaagcgtcgctcaatttacccagcagtttaaaactcgtctcgatgatatt
agtgcccaattaacccgtttagaagagtgcgagcaagctctaaatgctgcattgcaggct
aaaaatgaagcgcaacagttgctacaagccaaacagtcagaacttgcagtttctctgcag
cagcgcgaaacctttgaaaagcaatttaacgaacgcaatgtagagctagagaacaaaaca
caagggattaataatagtattttagcgcttagcgaaactatgacggcgcacggtgctgat
attcacaacttggctattgatggaattgccacgtggttaaatgaaaaagccgaagcgctt
aaaacctataaacacaatcatcagctacacgccaaacttaaagatgagttgcaaggggta
agtagcgccttgcttgtggttaatcgtgatatcgagagcgccgagaatcagctaaaggat
gtatctgaagagcttgtgcagctagataatagtttaaaggcgctgcgagactcgcgcaca
accgtattccctgaagggaatattgctgaaacaaggaataaggcaaacgccgcccaagaa
atggctgagcgaaatgtaaatgaatgcaaatctcgtctacaacaaacggacactatattg
tctcgtttagaagccgaaattgcccagcttaatgagcaaatgcgcgaaaaagagcaggca
cttacagaggcaacagagcactttagtcgtcagttggcgagcagcccatttgacgatgag
caagcgtttagtaatgcgcttttagacgaagatacccgcaacaccttgcttgaactgcaa
aagcgattagctcagcaaaaacaacaagcggacttaaagctagaaaacgcgctagctacc
caacaatcgctaaaagcccatgctaacgcagcacagtggcagagcgagttagaagagcac
ggtgcacagtggctcgatacgaaaattacccagcaagctcagcagcgtgacacgctgtta
tcttctttagggcaaattgaacagcagctaagcgctaacaatcaagcccgcgaaaggcag
caacagcttgtggatgagatggctgcgtttgaggcctattacgatgatattacttacctg
cactcgttaattggctcggcaagcggcgacaaattcagacgttttgctcaagggcttact
ctggacaacttagtgcagcttgctaatcagcagctggataaattacacggtcgctatcag
ctaattcgaaaagaaaacgaagggttgggtttaagtgtattagacacctggcaaggtgac
gtggtgcgagacaccaaaaccctgtccggcggagaaagtttcttagtgagccttgcactg
gcattagctttatctgacttggtcagtcacaagaccagtattgattcgctgtttttggat
gaaggctttggcaccctagatgctgaaactttggatgtggcccttgatgcactagacaac
ttaaatgccagcggaaaaatgattggtgtaataagccatattgaagccatgaaagagcgt
attcctactcagcttaaagtgattaaacgcaacggtgtggggttaagtgcactagaaaaa
ccttatgcggtggggtga

DBGET integrated database retrieval system