KEGG   Alteromonas macleodii English Channel 673: AMEC673_08055Help
Entry
AMEC673_08055     CDS       T02254                                 

Definition
(GenBank) zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
amg  Alteromonas macleodii English Channel 673
Brite
KEGG Orthology (KO) [BR:amg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:amg01002]
    AMEC673_08055
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:amg04147]
    AMEC673_08055
   04090 CD molecules [BR:amg04090]
    AMEC673_08055
Enzymes [BR:amg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AMEC673_08055
Peptidases [BR:amg01002]
 Metallo Peptidases
  Family M2
   AMEC673_08055
Exosome [BR:amg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMEC673_08055
CD molecules [BR:amg04090]
 Proteins
  AMEC673_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AFT74305
LinkDB All DBs
Position
complement(1905890..1907710)
Genome map
AA seq 606 aa AA seqDB search
MLNHKRTLIAALVSVSLMGCGESTTQTETKPQLTAQDAKQFLTQAQNDIAKMQVPAAHAE
WSYATNINFDTAAVSAYFNEVLSTKVAKLAKEAAKFNDVDVDADTRRQLDLLKNSLTMPP
PADAEKAERLAKIGSDLSAMYGSGEYCSEDGTCKSLVEMSSEMATLRDADKLLEYWTGWR
EVSKPMAGLYAEQVSLANEGAAELGFENVSALWRGKYDMPADEFPKELDRLWTQVEPFYE
SLHCHVRAKLGEHYGEDVVPQDKPIPAHLLGNMWAQSWGNIYDIVKPQQEMKVPDVTGAL
AEQGYDEIAMVKQAESFFSSLGFEELPDTFWERSMFQKPEGRDVQCHASAWDLDDKDDLR
IKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSITPKYL
KQIELIDEIPDASNDIGMLMQVALDKIAFIPFGLMVDQWRWKVMSGEVTPEQYNQLWWEL
REKYQGVMAPVERSADAFDPGAKYHVPANVPYTRYFLAHILQFQFHKALCDIAGDEGPLN
RCSIYGSEEAGKALNEMLEMGMSQPWQNALETLTGSPQMDASTIADYFAPLKTWLDEQNA
TRQCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatcacaaacgtactctgatagcagcattggtaagcgtttcgcttatgggatgt
ggcgaaagtacaacacagacagaaactaaaccgcaactcactgcacaagacgccaagcag
tttttaacacaggcgcaaaatgatattgcaaaaatgcaagttcctgccgcgcacgccgag
tggagctacgccacgaatatcaatttcgatacagcagcagtcagtgcttactttaatgaa
gtgctttctaccaaggttgcaaagttagctaaagaagcggcgaaatttaacgatgtagac
gtagatgccgacacccgcagacagcttgatctacttaaaaacagtttaacaatgccgccg
ccggcagatgcggaaaaagcagagaggcttgcaaaaattggttctgacttaagtgccatg
tacggctctggtgagtattgcagcgaagatggtacgtgcaaaagcttggttgaaatgagc
tctgaaatggccaccctacgcgatgctgacaagctactagaatattggacaggttggcgt
gaagtatctaaaccaatggcaggactctatgcagaacaagtatcgcttgccaatgaaggc
gctgcagagctaggttttgaaaacgtcagcgccttgtggcgtggaaagtacgatatgcca
gcagatgaatttccaaaagagttggatcgcttatggacgcaagtagagcctttctacgag
tcactacattgccatgtgcgcgctaagctaggtgaacactatggcgaagacgtagtacct
caagacaaaccaattccagcccatttattaggtaacatgtgggcacagtcgtgggggaat
atttacgatatcgttaaacctcagcaagaaatgaaagttcctgatgttacaggcgcatta
gctgaacaggggtatgacgaaatcgccatggttaaacaagcagagtcatttttctcatcg
cttggctttgaagaacttccagataccttttgggaacgctctatgtttcaaaagcctgaa
ggccgtgacgttcagtgtcatgcctctgcgtgggatttagatgacaaagacgatcttcgt
ataaagatgtgtattcaaaagactggcgaagaatttaacgttattcaccacgaattaggt
cacaactactatcaacgcgcttataaagaccaaccacttctttaccgtggttcggcgaac
gacggcttccacgaggctattggcgacaccatcgctttatcaataacacctaagtacctt
aagcaaatcgagttaattgatgagatcccagacgcatcaaacgatatcggtatgttaatg
caagttgcgttagacaagattgccttcattccctttggtctgatggttgaccaatggcgc
tggaaagtgatgtcaggtgaagtaacacctgaacaatacaatcaactatggtgggaattg
agagaaaagtatcagggtgtgatggcccctgttgagcgcagcgccgacgcgtttgatccg
ggtgcaaaatatcacgtgcctgcgaacgtaccttatacacgctatttcctagcgcatatc
cttcaattccagttccataaagcactgtgtgacattgcaggtgatgagggcccgcttaac
cgttgttctatctacggcagtgaagaagccggtaaagcacttaacgaaatgctagagatg
ggtatgagccaaccttggcaaaatgcgttagaaacactgacaggctcaccgcaaatggat
gccagtactatcgcagactactttgcgccactaaaaacgtggttagatgagcaaaatgct
acacgccagtgtggctggtaa

DBGET integrated database retrieval system