KEGG   Alteromonas macleodii English Channel 673: AMEC673_09915Help
Entry
AMEC673_09915     CDS       T02254                                 

Definition
(GenBank) 3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00061  Fatty acid biosynthesis
amg01100  Metabolic pathways
amg01212  Fatty acid metabolism
Module
amg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AMEC673_09915
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amg01004]
    AMEC673_09915
Enzymes [BR:amg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AMEC673_09915
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AMEC673_09915
Lipid biosynthesis proteins [BR:amg01004]
 Fatty acid synthase
  Component type
   AMEC673_09915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AFT74677
LinkDB All DBs
Position
complement(2337925..2338443)
Genome map
AA seq 172 aa AA seqDB search
MSEKKNSFNKEDLLACSRGEMFGPGNSQLPAPNMLMMDRVVSITEDGGEHGKGEIIAELD
ITPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFFLGWSGGPGKGRALGVGEVKFTGQILP
TAKKVTYKITMKRVIKRKLFMGMADGSVEVDGREIYVAKDLKVGLFQDTSNF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagaagaaaaatagttttaacaaagaagatttattggcgtgtagccgtggtgaa
atgtttggcccaggtaacagtcaacttcccgcacctaacatgttaatgatggaccgcgta
gtttcaattacagaagatggcggtgagcatgggaaaggcgaaattatcgctgaattagat
attacccccgatttatggttttttgattgtcacttcccaggtgatccggtaatgccggga
tgcctaggcctagacgcgatgtggcagttagttggtttcttcttaggttggagcggcggc
cctggtaaaggccgagctttaggtgtaggtgaagttaaatttaccggtcaaatccttcca
accgctaagaaggtaacgtataagatcacgatgaagcgcgtgataaagcgtaaactcttc
atgggtatggcagatggttcagtagaagttgatggccgtgagatttacgtagcgaaagat
ttgaaagttggcttgttccaagatacctcaaacttctaa

DBGET integrated database retrieval system