KEGG   Alteromonas macleodii English Channel 673: AMEC673_11050Help
Entry
AMEC673_11050     CDS       T02254                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg00500  Starch and sucrose metabolism
amg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMEC673_11050
Enzymes [BR:amg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMEC673_11050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AFT74902
LinkDB All DBs
Position
2584826..2586241
Genome map
AA seq 471 aa AA seqDB search
MKMKKHAAGVLIGAALSTLSYQSYADVILHAFNWTYDDVAAKAQEIADLGYTKVLVSPAY
KSTGDQWWARYQPQDYRVIDNPLGDTADFQAMVNALNAKGVETYADIVFNHMANEAWKRS
DLNYPGSEVLQQYSSNQGYYNGITLFGDVSSGLFGGGDFHGTYDQGGPKCISNYSDVGDV
QYNRLCGAAPDPGLPDLDPNNWVVAQQKAYLQALKDMGVTGFRVDAAKHMTNYHINAVFD
SNIKNGVHVFGEIITTGGAGSSEYENFLAPYLSATGHSAYDFPLFAQIRSAFSFGGSMNA
LVDPGAYGQALSGDKAITFSITHDIPLNDGFRYQLLDPTDEHLANAYVLGRDGGVPLLYS
DNNESGDNRWVDLYKRDDIKGMVKFHNGVQGSGMQVVSHNDCVIFFKRDHQGVVGINKCA
DGQDIWVDTSTDNLWWYRNYRDTLSNDVQYITTQWHKFYVPGRSARMWLME
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaagaaacatgcggcaggcgttctaataggcgcagcactgagtacattaagt
tatcaaagctatgccgacgttatactacacgcatttaactggacctacgacgacgtagcc
gcaaaagcccaggaaattgcggatcttggttacaccaaagtacttgtttcgcctgcttat
aaatcgacaggtgaccagtggtgggcgcgatatcaaccacaggactatcgagttattgat
aacccacttggtgacactgctgactttcaagcgatggttaatgcattaaatgccaaaggt
gtagagacctatgcggatattgtctttaatcatatggcgaacgaagcatggaaacgttca
gacttaaactaccctggaagtgaagtactacagcaatactcatcaaaccagggatactac
aatggcatcacattatttggtgatgtaagtagcggcctttttggcggtggtgacttccac
ggtacgtacgatcaaggtggccctaagtgcattagtaactacagcgacgtgggcgatgtt
cagtacaatagattatgcggcgccgcgccagatcctggcttgcccgacctagaccccaat
aattgggtagtagcccagcaaaaagcgtatcttcaggcgttaaaagacatgggtgtaacc
ggttttcgcgttgatgctgcaaagcacatgaccaactatcatatcaacgcggtattcgac
agcaatataaaaaacggcgtgcatgttttcggagaaataattaccacgggcggtgcaggc
tctagtgagtatgaaaacttccttgcaccttatttatcagcaacaggtcactcggcctac
gacttcccgcttttcgcgcaaatacgcagtgcatttagcttcggtggttcgatgaatgcc
ttagttgacccaggtgcgtacggtcaggctttatcaggcgacaaggccatcacatttagt
attacccacgacatcccgctaaacgacggcttccgctaccagttacttgaccctaccgac
gaacatttggcaaatgcctatgtactagggcgtgacggtggtgttccattactgtactca
gataacaatgaaagtggtgataatcgttgggtagatttgtacaagcgtgatgacatcaag
ggtatggttaaattccataacggagttcagggcagtggcatgcaagtggtaagtcataat
gactgcgttattttcttcaagcgtgaccatcaaggcgttgtgggtattaataaatgcgca
gacggccaagatatttgggtagatacatctacggacaatttgtggtggtatagaaattac
cgcgatacgttaagtaatgatgtgcaatatattacaactcagtggcacaagttctatgta
ccaggaagaagcgcccgaatgtggcttatggaataa

DBGET integrated database retrieval system