KEGG   Alteromonas macleodii English Channel 673: AMEC673_17835Help
Entry
AMEC673_17835     CDS       T02254                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
amg  Alteromonas macleodii English Channel 673
Pathway
amg03030  DNA replication
amg03410  Base excision repair
amg03420  Nucleotide excision repair
amg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:amg00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AMEC673_17835
   03410 Base excision repair
    AMEC673_17835
   03420 Nucleotide excision repair
    AMEC673_17835
   03430 Mismatch repair
    AMEC673_17835
Enzymes [BR:amg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AMEC673_17835
    6.5.1.6  DNA ligase (ATP or NAD+)
     AMEC673_17835
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     AMEC673_17835
DNA replication proteins [BR:amg03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    AMEC673_17835
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     AMEC673_17835
DNA repair and recombination proteins [BR:amg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     AMEC673_17835
   NER (nucleotide excision repair)
    Other NER factors
     AMEC673_17835
   MMR (mismatch exicision repair)
    Other MMR factors
     AMEC673_17835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_A_N mRNA_cap_enzyme Peptidase_M75 NEMO
Motif
Other DBs
NCBI-ProteinID: AFT76243
LinkDB All DBs
Position
4194770..4196455
Genome map
AA seq 561 aa AA seqDB search
MKAFSNLLEQLYYTSGNKAKAQLIADYIANTPDPDRGWAIAAMAGTLRFDFFKRNTVKKL
ITEHTDSALFAMSYDYVGEVSETVAHLWPYSEPTDNLPSLTEVVETFASVSKQKVSETLA
NYLTIMTPAQRWALLKLGTRGLRIGVSARSIKQILADYGNKDIKEIETLWHAVTPPYTDM
LAWLEGKADKPDIENAVTFHPVMLSHPIEDSDIDAFTENTWQIENKYDGIRVQLAVKSEP
IASKCATRKDQNDNKKGQTIDEETPDKALFSRTGDDISHSFPDLLETVKGNMVLDGELLV
IHNVKGDAYDAMASQPNVDTFNALQQRLNKKKPSKALQASSPVGLIVYDALVLDGKDLTE
KTLKERRQALHEWFNHNKSERLFLSETLSASSPKSLRELHAHVCQNRAVEGLMIKRLDSK
YIPGRPKGQWFKWKRDPLVVDAVMMYAQRGHGKRSSFYSDYTFGAWEDDQLLPIGKAYSG
FTDEELKKLDNWVRRNAVGRFGPVREVKKDLVLEVAFDAVHPSSRHKSGVALRFPRIHRI
RWDKPAAEADTLTNVKALIEN
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttagtaatttgcttgagcaactttattacacgtcgggaaacaaagccaaa
gcgcaactcattgctgattacattgccaacacacctgaccctgatcgtggctgggctata
gccgctatggccggtacgttgcgattcgatttttttaagcgtaacactgtgaaaaagctc
attaccgaacacactgactctgcgctttttgcaatgagctacgattatgtgggagaggtt
agcgaaaccgtggcgcatttatggccttacagtgaacctacggataatcttccaagtctt
actgaagtcgtagaaacctttgcgtctgtgagtaaacagaaggtgtcggaaacgctagcc
aactacctgacgataatgacccctgcacagcgctgggctttattgaaacttggcacccgc
ggattgcgcataggcgtgtcggctcgctccattaaacaaatactggccgattatggcaat
aaagatatcaaagaaattgaaacgctgtggcacgcggttacaccaccctacaccgacatg
cttgcttggctagaaggcaaagctgacaaacctgacattgaaaatgcagttactttccac
cccgtgatgctctcccaccctattgaggacagcgatattgatgcttttacggaaaacacg
tggcaaattgaaaacaagtacgacggtattcgcgttcagcttgctgttaaatcggagcct
attgccagtaaatgcgccacaagaaaagaccagaacgataacaaaaaagggcaaacaata
gatgaagagacgccggataaggcgcttttctcacgcacaggagatgacattagccattct
tttcccgacctacttgaaacggtaaaaggaaatatggtgttagacggcgaactactggtt
attcataacgtaaaaggcgacgcttatgacgctatggcttcacagccgaatgtcgacaca
ttcaatgcacttcagcaacgcctcaacaagaaaaagccaagtaaagcactgcaagcgtct
tcacctgttggacttattgtctacgatgccttggtgctagatggcaaagatttaactgag
aaaacgttgaaggaacgtcgccaggcgctccacgaatggtttaaccataacaaaagcgag
cgcttgtttttatcggaaaccctttctgcgagctctcctaaaagccttcgtgaacttcac
gctcacgtttgtcaaaatcgcgcggtggaagggttgatgataaagcgcttagatagcaag
tacatccccggccgtcccaaagggcaatggttcaagtggaagcgcgacccgctggtggtt
gatgcggtaatgatgtacgcgcagcgagggcacgggaaacgatcgagcttctattccgat
tacacgttcggtgcatgggaagacgaccagcttctgccaataggaaaagcatattctgga
tttaccgacgaagaacttaagaagctagacaactgggtacggcgcaatgcagttggacgc
tttggccctgtgcgggaggtaaagaaagatctggtgttagaagtggctttcgacgcggtt
catccttcctcaagacataaatcgggggtagcgctgcgcttccctcgcattcaccgtatt
cgttgggataaacccgccgccgaagctgacacgctaaccaacgttaaagcgttaatcgaa
aactaa

DBGET integrated database retrieval system