KEGG   Alteromonas mediterranea 615: I633_02935Help
Entry
I633_02935        CDS       T02719                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00071  Fatty acid degradation
amh00280  Valine, leucine and isoleucine degradation
amh00281  Geraniol degradation
amh00310  Lysine degradation
amh00362  Benzoate degradation
amh00380  Tryptophan metabolism
amh00410  beta-Alanine metabolism
amh00640  Propanoate metabolism
amh00650  Butanoate metabolism
amh00903  Limonene and pinene degradation
amh00930  Caprolactam degradation
amh01100  Metabolic pathways
amh01110  Biosynthesis of secondary metabolites
amh01120  Microbial metabolism in diverse environments
amh01130  Biosynthesis of antibiotics
amh01200  Carbon metabolism
amh01212  Fatty acid metabolism
Module
amh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    I633_02935 (fadB)
   00650 Butanoate metabolism
    I633_02935 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I633_02935 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I633_02935 (fadB)
   00310 Lysine degradation
    I633_02935 (fadB)
   00380 Tryptophan metabolism
    I633_02935 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    I633_02935 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    I633_02935 (fadB)
   00281 Geraniol degradation
    I633_02935 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I633_02935 (fadB)
   00930 Caprolactam degradation
    I633_02935 (fadB)
Enzymes [BR:amh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     I633_02935 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     I633_02935 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     I633_02935 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     I633_02935 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 5_3_exonuc_N
Motif
Other DBs
NCBI-ProteinID: AGP76887
UniProt: S5A937
LinkDB All DBs
Position
complement(570241..572391)
Genome map
AA seq 716 aa AA seqDB search
MIYTGKSLSVSLLDDGFAELVFDAEGSVNKFDRQTVSELDEATQALLAKGDVKGLVVRSA
KPAFIVGADITEFTGLFTMDDAEVLQWVANTSQVFDRFEDLPFPTIAAVNGFALGGGCEM
ALACDMRIADTTASIGLPEVKLGLMPGFGGTVRLPRLIGADNALEWMTTGRDRKGAKALA
EGAVDAVVAPEALVEGALSMVKDAAEGKFDWQARRAVKKAPLQLNKNEAMMSFSTAQAMV
FAQAGKHYPAPHKMVETVQKAAGLDRDGALKLENEGFVALAKTDAAKAQIGIFLADQLVK
GKGKKQAKAATKQSKLNAVLGAGIMGGGIAYQSAVKGTPVIMKDINQGALDLGLSEAAKI
LGKGMKRGKVDATKMAQTLNAITPTLEYSTLKDADLVIEAVVENPKVKGIVLKEVEDNVA
DDAIITSNTSTISINQLAKSLDKPERFCGMHFFNPVHRMPLVEIIRGEKTSEETINAVVA
ATLKMGKTPIVVNDCPGFLVNRVLFPYFAGFSKLLIDGADFVAVDKVMEKIFGWPMGPAY
LMDVVGIDTGDHAADVMAAGIPERMARLDNDPVTLFYKEERLGQKNGKGFYNYGVDKRGK
PKKTPAEEAYALMAPHVAEKTDFEADDIIARLMIPMANEAIRCLEEGIVDSAAEADMALL
YGLGFPPFRGGIFRWIETIGLANFVAMADKYAELGPIYQISDGVREMAASGKSYFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgatatacacaggcaaaagtctttccgtcagcctgttagatgacggctttgctgagctg
gtattcgacgccgaaggttcagtaaacaagttcgaccgccaaacagtgagcgaacttgac
gaagcaacccaagccctacttgctaaaggcgatgtaaaaggcttagtagtacgcagtgca
aaacctgcatttatcgtaggtgcagatatcaccgagttcactggtcttttcactatggac
gatgctgaagtactacagtgggttgccaatacgtcacaagtattcgaccgattcgaagac
ctacctttccctaccattgctgctgttaatggctttgcgctaggtggtggttgtgagatg
gcattggcgtgtgacatgcgtattgcagacacaacagcttcaatcggtttaccagaagtt
aagctaggccttatgcctggttttggtggcacggttcgccttcctcgcttaataggtgca
gataacgcccttgagtggatgactactggccgtgacagaaaaggcgcgaaagcccttgct
gaaggcgcggttgatgccgttgttgctccagaagcacttgttgaaggcgcactttcaatg
gtgaaagacgcagcagagggcaagtttgattggcaagctcgtcgtgcggttaagaaagcc
ccactacagctaaacaaaaacgaagctatgatgagcttctcgacagctcaagccatggta
tttgcccaagctggcaaacactacccagctcctcacaaaatggttgagacagtacaaaaa
gcagctggcctagaccgtgacggcgcacttaagcttgaaaacgaaggctttgtagcgctt
gcaaaaaccgacgcagcgaaagcgcaaattggtattttccttgccgaccagctggttaaa
ggtaaaggtaaaaagcaggcgaaagcagccactaagcaatctaagcttaacgctgtacta
ggtgcaggtatcatgggcggcggtattgcataccaaagcgctgtgaaaggcacgccagtt
atcatgaaagacattaaccaaggtgcactagaccttggtctttcagaagccgccaaaatt
cttggtaaaggtatgaagcgcggtaaagttgatgcgactaaaatggcgcaaacgcttaac
gcaattacacctacccttgagtacagcacgcttaaagatgcagaccttgttattgaagcg
gttgtagaaaacccgaaagtaaaaggtattgtacttaaagaagtagaagacaatgtagcg
gacgacgctatcatcacttcaaacacttctactatctctatcaatcagctagctaaaagc
ttagacaagccagagcgcttctgtggtatgcacttcttcaacccagtgcaccgcatgccg
cttgttgaaattattcgtggcgaaaaaacgtcagaagaaaccatcaatgcagtagtagcc
gctacccttaaaatgggcaaaacccctattgtggttaatgactgcccagggttcttggta
aaccgcgtattgttcccatactttgcgggcttcagtaagctacttatcgacggcgctgac
tttgttgctgttgataaagtaatggaaaaaatcttcggctggccaatgggcccggcttac
ctaatggacgttgtaggtatcgacacaggcgatcatgcagcagacgtaatggcagcaggt
attccagagcgtatggctcgcctagacaacgacccagtaaccctgttctacaaagaagag
cgtttaggtcagaaaaacggtaaaggtttctacaactacggtgttgataagcgcggtaag
cctaagaaaacacctgctgaagaagcatatgcactaatggcgccccacgtagctgagaag
acagactttgaagctgacgacattattgcacgccttatgatccctatggcaaacgaagca
attcgctgcctagaagaaggcattgtagatagcgcagctgaagcagacatggcgctactt
tacggcttaggtttccctccattccgcggtggtattttccgttggattgaaaccattggc
ttggcgaactttgttgctatggcagacaagtacgctgaacttggtccaatttatcagatt
tcagatggcgttcgtgaaatggccgcttctggtaaatcctatttcgcataa

DBGET integrated database retrieval system