KEGG   Alteromonas mediterranea 615: I633_10565Help
Entry
I633_10565        CDS       T02719                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00010  Glycolysis / Gluconeogenesis
amh00030  Pentose phosphate pathway
amh00051  Fructose and mannose metabolism
amh00052  Galactose metabolism
amh00680  Methane metabolism
amh01100  Metabolic pathways
amh01110  Biosynthesis of secondary metabolites
amh01120  Microbial metabolism in diverse environments
amh01130  Biosynthesis of antibiotics
amh01200  Carbon metabolism
amh01230  Biosynthesis of amino acids
amh03018  RNA degradation
Module
amh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I633_10565
   00030 Pentose phosphate pathway
    I633_10565
   00051 Fructose and mannose metabolism
    I633_10565
   00052 Galactose metabolism
    I633_10565
  09102 Energy metabolism
   00680 Methane metabolism
    I633_10565
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    I633_10565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:amh01009]
    I633_10565
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:amh03019]
    I633_10565
Enzymes [BR:amh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     I633_10565
Protein phosphatases and associated proteins [BR:amh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     I633_10565
Messenger RNA biogenesis [BR:amh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     I633_10565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGP78082
UniProt: S5ADC7
LinkDB All DBs
Position
complement(2130559..2131653)
Genome map
AA seq 364 aa AA seqDB search
MLHYKRPLYVAYPLLYLNRIACKKKDFNVSKRVAILTSGGDAPGMNACIRATIIACQKAG
YTLLGYKHGYNGLLQQEYISLSLDSTHNLIQQGGTILHSARCKEFMHEEGLLKAAHNLKK
ARIDSLIVIGGDGSFKGAAKLSEHWDGQIIGIPGTIDNDIAGTDATIGYFTAIDTAMSSI
DKVRDTADAFERIFLVEVMGRNAGFLALNAALSSAADYVIVPEFFSSAESEIEKLVSQIN
AQRTLKGPVSFIVVVAENVWPNGLAGLTDALQQRNLQDVRPVTLGHVQRGGSPVAQDRLL
ATTLGEAAIRLVGKDISNVMVGEVNQRPVTVPLSETWKNTKPLNEARVGAMRTLMNERYN
QADN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattacaaacgtccactttacgtagcgtaccctttactttaccttaaccgtatt
gcctgtaaaaagaaggactttaatgtgtcaaaacgtgtcgcaattttaacatctggtggc
gacgcaccaggtatgaatgcatgtattcgggccactatcattgcctgtcaaaaagccggt
tatacactgttgggctataagcatgggtacaatgggctactgcagcaagaatatatttca
ttgtccttagactctacgcataaccttattcagcaaggcggtacaattttacatagcgca
aggtgcaaagagtttatgcacgaagaggggctgttaaaagcagctcataatttaaagaaa
gcgcgcatagattcattaattgttatcggcggcgacggctcgtttaaaggggctgctaaa
ttaagcgagcattgggatgggcaaattataggtatccctggcactatcgataacgacatt
gcgggaacagacgcaactatcggttatttcacggctattgataccgccatgagctctatc
gataaagtacgcgatactgccgacgcttttgaacgtatctttttagttgaggtaatgggg
cgcaatgctggcttcttagcccttaatgcagccctctcctctgctgcagactatgttatt
gttccagaatttttctcttcagctgaatctgaaatagaaaaactcgtgtcgcaaatcaac
gctcagcgaacgctgaaaggccctgttagttttatcgttgtggttgcagagaacgtatgg
cccaacggactagcgggcttaactgatgcccttcaacaacgaaatctacaagatgtaagg
ccggttactttaggtcacgttcagcgcggtggttccccggtagcgcaagaccgactttta
gcgactacgctgggagaagcggccattcgattggtgggaaaagacataagtaatgttatg
gttggtgaggttaatcagcgtccagtaaccgtgccattgtctgaaacgtggaaaaatact
aaaccgcttaacgaggcccgtgtcggcgccatgcgaacgcttatgaacgagcgttataac
caagcagataactag

DBGET integrated database retrieval system