KEGG   Alteromonas mediterranea 615: I633_16755Help
Entry
I633_16755        CDS       T02719                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
amh  Alteromonas mediterranea 615
Pathway
amh00052  Galactose metabolism
amh00511  Other glycan degradation
amh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    I633_16755
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    I633_16755
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    I633_16755
Enzymes [BR:amh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     I633_16755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1
Motif
Other DBs
NCBI-ProteinID: AGP79058
UniProt: S5AQ02
LinkDB All DBs
Position
3418437..3421154
Genome map
AA seq 905 aa AA seqDB search
MLFIRNYKGLLALTLLLLATNVTAKQREKIDFTGEWRFYRYADNQTPDSLIYDTRPNVNQ
FDDSQAADTRPSDAVTVNSHDGVLKSWILPTGNAFIANPDKRHVRPEGEPGKDFPFVQRA
FDDSHWKVVNLPHDWAIAGPFYSGNNPKVGGGMGRLPSHGVAWYRKQFTLAKDDKNKRIY
LHIDGAMSYSMVWLNGHLVGGWPYGYSSYQLDLTPYVTVGQTNQLAIRLDNPPKSSRWYP
GGGIYRNVWLEKTAQIHISQWGTQVITPTVSKDKATISITTSIRNHTKNDQNVSLQHHIY
ELSKQDTLSEKPVLTLPSQALTLASGEEQKSQATSVLKNPKLWGPIPHQTPHRYAVVTSV
IQNGKTLDQYTTPFGVRKLAFNPDTGVVVNGEHIPLQGVNQHHDLGALGAAFNLRAAQRQ
LNILQEMGVNAIRMAHNPPAPELLTLTDKMGILVLNESFDSWYKKKTPLDFHLIFADWHE
QDLRALVRRDKNHPSVIMWYIGNEVGEQYTGEDGAEIALKLKSIVKSEDPTRPVTASMNW
AKADFPFSAAMDVISLNYQGEGIRQEPEFENTDRIRTPPSYPAFREAHPDKVILSSETAS
AYSSRGLYFFPVTPKTSAPVRDGLGGNSKIHQVSSYELHAVDFGASADKVFRYLDTYPFV
AGQFVWNGFDYLGEPTPYYAARSSYSGMIDLAGFKKDRFYLYQSEWRPDLPMAHILPHWN
WSGREGEITPVHVFTSGDEAELFINGQSQGKKKKGPFEYRLRFDDVRYTPGTVEVVTYKN
GKRWATDSVTTSGVPSGLRLSADRNIINADGKDLSFVTVDIVDKKGNPVPTATHRVHFSL
TGPGRIVATDNGDSTNFTPFPSHERKAFSGKLLVIIQSEHNKPGELKLTASSQALEPAVL
TLRAN
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgctatttattaggaattataagggactacttgcccttaccttgctactgttagccaca
aatgttacagccaagcaacgagaaaaaattgattttactggagaatggcgattttaccgc
tacgccgataatcaaacgcctgatagcttgatttacgatactcgccccaacgttaaccag
tttgacgacagccaagcggcggatactcgcccttccgatgcggtaacagttaatagccac
gatggcgtattaaaatcctggattcttcccacgggaaatgcgtttattgctaaccccgat
aagcgccatgtaagacccgaaggcgaaccaggcaaagattttccatttgttcagagagcg
ttcgatgacagccattggaaagtggttaatttacctcacgactgggccatcgcagggcca
ttctatagtggcaacaatcctaaagtggggggcggtatgggacgtctaccctcccacgga
gtagcgtggtatagaaagcagtttacgcttgctaaagacgataaaaacaaacgtatttat
ctgcatatagacggcgcaatgtcttactcaatggtatggctaaatggtcatcttgtcggg
ggttggccttatggttatagctcttatcaacttgatcttacgccctatgtcactgttgga
caaaccaatcaacttgctattcgacttgataacccgccgaaatcttctcgctggtatccc
ggtggcggtatctatcgaaatgtatggttagaaaaaaccgcacagatccatatcagtcag
tggggaacgcaggtgatcacacctaccgtgtctaaggacaaggccacgatatcgattacc
acatcaatcagaaatcatacgaaaaatgatcagaacgtgagtcttcaacaccatatttat
gagctttcaaagcaagatacccttagcgaaaagccggtattaacgcttccttcccaagct
ttaacgttagcttctggagaagaacaaaaaagccaagctacttctgtgttaaagaacccc
aagttatgggggcctataccccatcaaacaccccatcgctatgcagtggttacgtcagtc
atacagaacggaaaaacacttgaccaatacaccacgcccttcggcgttcgcaagttggcg
ttcaaccctgataccggcgtggtcgtcaatggtgagcacattccgctacaaggtgttaac
cagcaccatgatttgggcgccctgggcgctgcatttaatttgcgggcagcccagagacaa
ttaaacattcttcaggaaatgggggtaaacgctattcgcatggcacataatcctcccgcg
cccgaacttctgacgttaacggataaaatgggaattctagtattaaacgagtcgttcgac
agttggtacaagaaaaagacaccacttgattttcaccttatttttgccgattggcatgaa
caagatcttcgcgcgctagttcgacgcgacaagaaccatccttcggtgatcatgtggtat
atcggtaatgaagttggagaacaatataccggagaagatggggctgaaatcgccttaaaa
ctaaaaagtattgttaagagtgaggaccctacccgccctgttactgcatctatgaattgg
gctaaggctgatttcccgtttagcgcagctatggacgtaataagcctaaactatcaaggg
gaaggcatccgccaagagcctgaatttgaaaataccgaccgtattcgcactcccccctct
tatcccgcttttcgcgaagcacaccccgataaagtaattttatctagtgaaacagcctcc
gcttacagctctagagggctttacttctttcctgttacaccgaaaaccagtgcgccggtt
cgcgatggtcttggtggaaattcaaaaattcatcaagtcagtagctacgagctacatgcg
gtagattttggggcatcagccgataaagtttttcgctatctagatacctacccttttgtt
gctggccagttcgtatggaatggttttgattacctaggtgaacccacgccctactatgcc
gcgcgaagctcttattccggcatgatcgatctggctggtttcaaaaaggatcgcttctac
ctctatcagagcgaatggcgaccggatctgcctatggctcatattcttccccattggaat
tggtccggtagagagggagaaatcactcctgttcatgtgtttacctccggagatgaagca
gagctatttattaatgggcaatcacaagggaagaaaaagaaaggtccctttgaatatcga
cttcgctttgatgatgttcgctacacgccgggaacagtagaagtggttacctataagaac
ggcaagcgatgggcaaccgacagcgtaacaacttctggcgtcccctcaggtttacgttta
tccgcagatcgcaatatcatcaatgccgacggaaaggatctatcatttgttaccgttgat
atcgtagataaaaagggtaatccagtacccactgcgactcaccgcgttcacttttcgctc
actgggcctggccggatagtcgcaacagataatggagattcgacaaacttcactccattt
ccttctcacgagaggaaggcgtttagtggaaagctacttgttatcattcaaagtgaacac
aacaagcctggagaattaaagcttaccgcgagcagccaagctttagagcctgcagtcctg
acactgcgtgcaaactaa

DBGET integrated database retrieval system