KEGG   Actinosynnema mirum: Amir_1579Help
Entry
Amir_1579         CDS       T00957                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
ami  Actinosynnema mirum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C TM1506
Motif
Other DBs
NCBI-ProteinID: ACU35528
UniProt: C6WBG0
LinkDB All DBs
Position
complement(1740560..1741636)
Genome map
AA seq 358 aa AA seqDB search
MPLPLTPPVQPMLATSADAIPTTSDLLFEPKWDGYRCLVFRDGSEVVLQSRGGKPLNRYF
PEVEAALRGSALPDRVVLDGELVVSLDGRLDFDALTERIHPAASRVALLSERTPAGFVAF
DLLALGDEVLLDRPTSDRRAALEDVITPSGALHLTPCTGDVELARRWFGLFEGAGLDGVV
GKAAGGAYLPGKRAMVKVKHARTAECVVAGLRWHKDTEPGTAAGSLLLGLHDDAGVLHHV
GVVGSFKAAERRSLAEELTPLITDGEHPWVGHSDERRTPGGTNRWRKESDWTPLTPERVL
EVSYSQTEGAAPARLRHNGQFRRWRPDRDAASCRYDQLDQPARYDLAAVLRGEVRKAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctcccgctgaccccgcccgtgcagccgatgctggccacgagcgcggacgccatc
cccaccacctcggacctgctcttcgagcccaagtgggacggctaccgctgcctggtgttc
cgcgacggctccgaggtggtcctccagtcccgcggcggcaagccgctgaaccggtacttc
cccgaggtggaggccgccctgcgcggctccgcgctcccggaccgcgtggtcctggacggt
gagctggtcgtctccctggacgggcggctcgacttcgacgccctcaccgagcggatccac
ccggcggcgagccgggtcgcgctgctgtccgagcggaccccggccggtttcgtggcgttc
gacctgctcgccctgggtgacgaggtcctgctcgaccggcccacctcggaccggcgggcg
gccctggaagacgtgatcacaccgtccggcgcgctgcacctgaccccgtgcaccggggac
gtcgagctggcccgccgctggttcgggctgttcgagggcgccgggctggacggggtggtc
ggcaaggccgcgggcggcgcctacctgccgggcaagcgggccatggtgaaggtcaagcac
gccaggaccgccgagtgcgtggtcgccgggctgcgctggcacaaggacaccgaacccggc
acggcggccggttccctgctgctcggcctgcacgacgacgccggggtgctgcaccacgtg
ggcgtggtcggctcgttcaaggcggccgagcgccggtcgctcgccgaggagctgaccccg
ctgatcaccgacggcgagcacccgtgggtcggccactcggacgagcgtcgcacgccaggg
ggaacgaaccgctggcgcaaggagtccgactggaccccgctgacccccgagcgcgtgctg
gaggtgtcctacagccagaccgagggcgccgcccccgcccgcctgcgccacaacggccag
ttccgccgctggcgccccgaccgcgacgccgcctcctgccgctacgaccagctcgaccag
cccgcccgctacgacctggccgccgtgctgcgcggcgaggtcagaaaggcccgctag

DBGET integrated database retrieval system