KEGG   Actinosynnema mirum: Amir_2002
Entry
Amir_2002         CDS       T00957                                 

Definition
(GenBank) Nucleotidyl transferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
ami  Actinosynnema mirum
Pathway
ami00525  Acarbose and validamycin biosynthesis
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    Amir_2002
Enzymes [BR:ami01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     Amir_2002
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: ACU35950
UniProt: C6WFL5
LinkDB
Position
2218765..2219871
AA seq 368 aa
MTADVRAALLAGGLGERMGRLTDHTCKPLVPYAASCRLVDFSVANAVRSGIPEVVLMSLH
RERDLIDHLRRNWDGNGLRVHFGPHDALVRSGHDGPLPERPPERGTADALLANAEHVFAP
GARDVLVQHADHVYDLDYGPMVAAHRAADADVTIGVQRIERRYVSLFGMVEVDDALAVRR
LVEKPENPTSDLVFTAFCLFKADVLERVLAELDAQPQDAWQHDISRDVLPHMIAQGHRVL
AHPISCYWADIGTVARYREEHLKLLTTPSPLPLDALPRTLAGEPPRFDPLTGSLLPHRLP
DGVDLRGVDLRDSVVFPGAVVEPGALVHGSVLLPGAVVPAGVEARDTVVDDHLAESREGV
TALEPANR
NT seq 1107 nt   +upstreamnt  +downstreamnt
gtgaccgccgacgtccgcgccgccctgctcgccggaggtctcggcgagcgcatgggcagg
ctcaccgaccacacctgcaaaccgctggtgccgtacgcggcctcgtgcaggctggtcgac
ttcagcgtcgccaacgcggtccgctcgggcatccctgaggtggtgctgatgtcgctgcac
cgcgagcgcgacctgatcgaccacctgcgccgcaactgggacggcaacggcctgagggtc
cacttcggaccgcacgacgccctcgtccgctccggccacgacggcccgctgccggagcgc
ccgccggagcgcggcacggcggacgccctgctggccaacgcggagcacgtgttcgcgccg
ggcgcgcgggacgtcctggtgcagcacgccgaccacgtctacgacctggactacggcccg
atggtcgcggcccaccgggcggcggacgcggacgtcacgatcggcgtgcagcgcatcgag
cgccgctacgtgtccctgttcggcatggtcgaggtggacgacgcgctggccgtgcgcagg
ctcgtggagaagccggagaacccgacctcggacctggtgttcaccgcgttctgcctgttc
aaggcggacgtgctggagcgggtcctcgccgagttggacgcgcagccgcaggacgcctgg
cagcacgacatcagccgcgacgtcctgccgcacatgatcgcgcagggccaccgcgtcctg
gcccacccgatctcctgctactgggccgacatcggcaccgtcgcccgctaccgcgaggag
cacctgaagctgctgaccaccccgtccccgctcccgctcgacgcactgcccaggaccctg
gcgggcgagccgccgcgcttcgacccgctgaccggcagcctgctcccgcaccgcctcccg
gacggggtggacctgcgcggcgtcgacctgcgcgacagcgtcgtgttccccggcgcggtg
gtcgaaccgggcgcgctcgtgcacggctcggtgctcctgcccggcgcggtcgtcccggcg
ggcgtggaggccagggacaccgtggtcgacgaccacctggccgagtccagggagggagtg
accgccctggaaccggccaaccgctga

DBGET integrated database retrieval system