KEGG   Actinosynnema mirum: Amir_2104Help
Entry
Amir_2104         CDS       T00957                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ami  Actinosynnema mirum
Pathway
ami00250  Alanine, aspartate and glutamate metabolism
ami00410  beta-Alanine metabolism
ami00640  Propanoate metabolism
ami00650  Butanoate metabolism
ami01100  Metabolic pathways
ami01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Amir_2104
   00650 Butanoate metabolism
    Amir_2104
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Amir_2104
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Amir_2104
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ami01007]
    Amir_2104
Enzymes [BR:ami01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Amir_2104
Amino acid related enzymes [BR:ami01007]
 Aminotransferase (transaminase)
  Class III
   Amir_2104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACU36049
UniProt: C6WGY1
LinkDB All DBs
Position
2326533..2327825
Genome map
AA seq 430 aa AA seqDB search
MAHDELLARHRAVLPDWMALYYDHPIEITRGSGRHVTDGEGRTYLDFFAGILTNGVGYDI
AEISDAIRSQIDTGVLHSSTLYLIRSQVELAERIAGLSGIPDAKVFFTNSGTEANETALM
LACGHRRSDQVLALRNSYHGRGFAATGVTGLRAWSPTALSPLKVAWVHGGYRYRSPFRDL
SDADYVAACVADLRDVLNTATSGDVACMIVEPIQGVGGFTLPPDGLFAAFKEVLDEHGIL
LISDEVQTGWGRTGEHFWGIGAHGVTPDAMTFAKGLGNGLAIGGVVARGDVVDGLTANSI
STFGGNPVSTAGALATLDYLLDHDLQSNAAKLGARLISGLRDVAADHPLLGDVRGKGLMV
GLELVGEDRAPDPAAAVAVLEATRERGLLVGKGGLHGNVIRLAPPLSVTADEVEEALVAL
RDAVAEVSAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgacgagctgctggccaggcaccgggcggtcctgccggactggatggccctg
tactacgaccacccgatcgagatcacgaggggcagcggcaggcacgtcaccgacggcgag
ggccgcacctacctggacttcttcgctggcatcctcaccaacggcgtcggctacgacatc
gccgagatcagcgacgccatccggtcccagatcgacaccggcgtgctgcacagctccacc
ctgtacctgatccgctcgcaggtggagctggccgagaggatcgccgggctgtccggcatc
ccggacgccaaggtgttcttcaccaactccggcaccgaggccaacgagaccgcgctcatg
ctggcctgcgggcaccgccgcagcgaccaggtcctcgccctgcgcaactcgtaccacggc
cggggcttcgcggcgaccggcgtcacgggcctgcgcgcctggtcgccgaccgcgctcagc
ccgctcaaggtcgcctgggtgcacggcggctaccgctaccgcagcccgttccgcgacctg
tccgacgccgactacgtcgccgcgtgcgtggcggacctgcgggacgtgctgaacaccgcc
acctccggcgacgtcgcgtgcatgatcgtcgagccgatccagggcgtcggcgggttcacg
ctgccgccggacgggctgttcgccgcgttcaaggaggtcctggacgagcacggcatcctg
ctcatctcggacgaggtccagaccggctgggggcgcaccggcgagcacttctggggcatc
ggcgcgcacggcgtcacccctgacgcgatgaccttcgccaaggggctcggcaacgggctg
gccatcggcggcgtggtcgcgcgcggcgacgtcgtggacggcctcaccgccaactcgatc
tccacgttcggcggcaacccggtgtccacggcgggcgccctggcgacgctggactacctg
ctggaccacgacctccagtccaacgcggccaagctcggcgcccggctgatctccgggctg
cgcgacgtcgccgccgaccacccgctgctcggggacgtgcgcggcaagggcctcatggtc
ggccttgagctggtcggcgaggaccgcgcgcccgacccggcggcggcggtggccgtgctg
gaggcgacgcgcgagcgcggcctgctggtcggcaagggcgggctgcacggcaacgtcatc
cgcctcgccccgccgctgtcggtgaccgccgacgaggtggaggaggcgctcgtggcgctg
cgggacgcggtcgcggaggtgtcggcccgatga

DBGET integrated database retrieval system