KEGG   Actinosynnema mirum: Amir_2695Help
Entry
Amir_2695         CDS       T00957                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
ami  Actinosynnema mirum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 KR PS-DH Ketoacyl-synt_C PP-binding KAsynt_C_assoc adh_short Epimerase Thiolase_N GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NmrA RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACU36630
UniProt: C6WNW1
LinkDB All DBs
Position
3068486..3089818
Genome map
AA seq 7110 aa AA seqDB search
MSQPENAEPATTAAPLARLAGLPPAEQERVLLGVVHEQVVAVLKAALPDAPDRVAPERPF
KELGFDSLAAVDLHRRLSAATGLELPVTLVFDHPTPLAVARLARRLALGERAVPVVREPV
ARRERDDEPIAVVGIGCRYPGGSDTPEKLWDVVAGGRHVISDFPEDRGWDLDALFDPEPG
KPGKSYVRKGGFLTEAAEFDAAFFGISPREALAMDPQQRLVLETAWEALEHAGVDPLSLR
GSRTGVYIGVEPQEYGPRLHQAPEGLDGYLLTGNAPSVVSGRLAYSLGLEGPTVSIDTAC
SGSLVALHLAVRALRDGDCTAALAGGVAVMVHPGAFTAFSTQRGLAPDGVCKPFAAAADG
TGWAEGVGVVVLERLSDALRAGHRVLGVIKGTAVNQDGASNGLTAPSGPAQQRVILQALA
DAGLSTSDVDTVEAHGTGTRLGDPIEAQALLATYGQDRETPLWLGSIKSNIGHSQAAAGV
AGLIKVVYAMRERVLPRTLHVDAPSPHVDWSAGDIELLTEQRPWDSPDRPRRAGISSFGV
SGTNAHVVIEEPPAAPPVAPAKPVKAAKATRKSQKAKAAAPVPVPLLLSGRGEAALRGQA
TRLAEFLAGDAAATPDLVDTAHELALRRAALEHRAVLHATDRADALRGLAALAAGQDAPG
LVRGAATAGPTAFLFTGQGSQRLSAGRELYRAHPAFAKALDAACGWLDLQLDRPLGEVMF
AEPGTEAAALLDRTAYAQSALFALETALYRLVESWGLRPDYVAGHSLGGITAAHVAGVLS
LEDAALLVGARGRLMQALPEGGAMVSVRAPESEVLPLLEGREAEVRVAAVNGPAATVISG
VETAVLEVAGVLADRGVKTKRLTVSHAFHSPLMEPALADFRRVAEVMTYSAPTIPVVSDV
TGELATAEQLRSPEYWVDHVRQAVRFRDVVAELAARGVATFLELGPDAVLTAMAQDCVAE
IDTDTDTDFAFAALLRRDRDEVAEVRAAVALAHTRGQSVRWAELLPQGSGARVDLPRYAF
QRERYWLTGGSSAGGAVELGQLAADHPLVGAVVGLAGGDRVVLTGRVSPRTHPWLADHVI
SGSVLLPGTAFVELAVRAGDEVGCAVLEELTLEAPLVLPERGGVVLQVVVDAPDDGGRRT
VAVHSRPEHAPEDAGWTRHAGGVLSAQAPEPGERLETWPPRDAEPVDASTAYADLAALGY
GYGPVFQGLRKAWRRGTGPSAEVYAEVALPESVAASAASFGLHPALLDAALHAVDVAGTA
PGDPGEVRVPFAWNDVVLHATGASAVRVRISPAGSDAVSLTITDPAGAPVAAVGSFVSRA
VTAEQLAAARREHHESLLRQEWVSRPVPAGQVRPAAVLGAGHADLAALGAALTSGATVPE
TVVYHVPVSTGDVLVDVRAALDSVLTVVRQWLADERFGPSRLVVVTRGVRDADLAHTPVW
GLVRAAQAENPDRFTLVDLDDAPESAAQLLPAVATGEPELSVRDGKVSVPRLARVPVEEP
AADPWAGEGTTLVTGGTGGLGALVAKHLATRGARRLVLTSRRGPDAPGAADLVAELADLG
ATARVVACDVADRAAVADLLAGITDLTAVVHTAGVVADGTVGALTAERVDEVLRPKADAA
WHLHELTRGRDLTAFVLYSSLAALLDNPGQGNYAAANLFLNALAERRRAEGLPATALTWG
LWLGESGMGSVLDTTALHRIEASGMPGLTPEENLALLDAALTTTEPVLAPVRLDPTALRA
RPDGVPALLRVLAPTAARRAAGGAAQSGGDSLGARLAELPEADRDRVLLDLVRAHVAAVL
GHGGGDAIEPKRAFSEIGFDSLAAVELRNRLTTATGLRLPATLVFDYPTPLALVGHLKDK
ALGDRAAAAPVQRATATAVDDEPIAVVGMSCRFPGGVTTPEELWRLVADGVDGISRFPDD
RGWDVDSLYDPEPGKPGRTYSVEGGFLDDALDFDAEFFGISPREATAMDPQQRLLLETAW
EALERAGIDPTSLKGSPTGVFAGIMYHDYALRLKDIPEDLAGYLGNGSLASVASGRVSYV
LGLEGPAVSVDTACSSSLVSIHLAAQALRGGECSLALAGGVTVMATPDTFLDFSLQRGLA
ADGRSKSFSADADGTAWGEGVGVLVLERLSDARRNGHEVLAVVKGSAINQDGASNGLTAP
NGPSQQRVIRAALSMAGLSHTEVDAVEAHGTGTRLGDPIEAQALLATYGQDRTEPLWLGS
IKSNVGHTQAAAGVAGVIKMVMAMREGVLPRTLHVGERTPQVDWSEGAVELLTQARPWPE
TGRPRRAGVSSFGISGTNAHVVLEQAPAAEPVAPVEPVEPQSAESQPVEQRPSGLVPWVL
SARTGDALREQAARLREHVGSASPRDVGWSLATTRAALERRAVVVGEDAGQLGAGLSALA
SGEAAASVVDGEALSDPRVVFVFPGQGSQWAGMAVELLDSSPVFAERMRECAAALSPHVD
WNLVDVVRDAPGTPPLNRVDVLQPVLWAITVSLAELWKHHGVRPDAVVGHSQGEIAAAVV
SGALSLQDGAAIVALRSVLIGEELSGRSGMLSIQLPLDEVLPRLRGGLTIGALNGARSVV
VSGDPENLAALQAELTAEGVRARPVKIDYASHSPHVEVIRERLLAVIADVAPRAATTPFC
STVTGGFLDGATLDADYWYSNLREKVDFVGATRALLGSGHTVFVECSPHPVLPSAVQETA
DEDDREVVTVPTLRREDGGPRRLLLSLAQAWTRGVDVDWTTLLTGPAAPRRVALPTYAFQ
HRRFWLDATDGPGDVSSAGLGATGHPLLGATTTTAGNDGVLLTGRLALDTHPWLADHAAS
GVVLLPGTAFVELAVRAGDQVGCDRVDELTLEAPLVLPARGGTVLQVAVGAPDATGRRAV
SVHSRPEDADSSWTRHASGFLDHAPRTSPERLTAWPPPGAAKLDVDALYAELAAGGYAYG
PVFRAVRAAWRQGDVVFAEVALPEHADAAGFGLHPALLDAALHATGAREGGAEDGLIDLP
FAWTGVTLHASGATGLRVRLTPEGGGAVSLLLADPTGAPVATVDALVTRPIPAEALTGGS
GQDSLYRVDWTPVPAAGPVTGQVVVLDGPDLSALEQVPDWVVLPVSGQAARSTVDDVLSV
LREWIADERFAAARLALVTTGGVPAAGHAVDPVVAPVWGLVRAAQAENPDRFALLDLDVA
LSDSPENLAGAVTTPLGLGEPEVAVRGDALLVPRLARATDRPRAPFAWTAEDTVLITGGT
GGLGALLAGHLAGQGVRQLVLTSRRGPDAPGATELVARLADLGATARVVACDVADRDSVA
ELLADVDGLTAVVHTAGALADGLVSAMTPEQVDAVWLPKAEGARNLHELTSDLRAFVVFS
SAAGVVDGTGQGNYAAANTYLDALVEQRRATGLPGTSIAWGLWEHRSGMTGHLTEGDLAR
MARSGVRGLPAAEGLALFDAALALDAPLLVPVRLDLAALRTRGEELPRLFHGLVRPTRRA
ATAAGADRTPRDELLGLSAEDRGRVLLDLVRSHVAAVLGHGSGAEIEPRRAFGELGFDSL
AAVELRNRLTTATGLRLPATLVFDHPTPVALVAHLSESLGGAAPSAPTPVAATRADDGDP
IAIVAMGCRYPGDVTTPEELWKLVADGVDAIGGFPVDRGWDTDGIYDPEPGKPGRTYVRE
GGFLNDALGFDAGFFGISPREALAMDPQQRLLLETAWEVIERAGIDPTSLKGTPTGVFAG
VMYHDYGSRLKEVPEDLAGYLGNGSIASVLSGRVSYVLGLEGPAVSVDTACSSSLVTIHL
AAQALRAGECSLALAGGVTVMSAPDTFVDFSLQRGLARNGRSKSFSSDADGTGWGEGVGL
VLLERLSDARRNGHEVLAVLRGSAVNQDGASNGLTAPNGPSQQRVIRAALANAGLSHTEV
DAVEAHGTGTPLGDPIEAQALLATYGQDREIPLLLGSIKSNFGHTQAAAGVAGVIKMVMA
MREGQVPATLHVSERTDQVDWSEGAVELLTEARPWPETGRPRRAGVSSFGISGTNAHIVL
EQAPEPATRAVPAPEAVAPEAIEPDAAVPTGALLPLPVSGRGADAVRAQAGLLAAHLAAH
PDLAPLDVAHSLVTTRAALEQRAVVVGEDLERLTAGLSALASGEAAASVVDGEVLSDPRV
VFVFPGQGSQWVGMAAELLDASPVFAARMAECAQALSEFVDWDLIAVARGDEDAPSLERV
DVVQPVLWAMMVSLAELWRANGVRPDAVVGHSQGEIAAAVASGALSTRDGAAIVALRSLA
IAEDLAGKGGMLSVQLPVDEVRPRLAEGLSIAVVNGARSVVVSGDPAGLDALQAELRAEG
ARAKRVPVDYASHSAHVESIRERLLDVLADLSPRTSTTPFCSTVTAEFTDTTTLDAGYWY
TNLRETVDFVGATRTLLAGGHAVFVECSPHAVLTSAVLETAEEDGREVAAIGSLRRDDGG
PRRVLLSLAQAWTRGVDVDWTGLLADRATAAGATPRRIALPTYAFQHRRYWLDATSATGD
VTSAGLAATAHPLLGATIAVAGADEVLLTGRLAADTHPWLAHHAFAGTTLLPGTAFVELA
IRAGDQVGCDRVDELTLEAPLALPERGGVHVQLRIGDPDRDGGRELTVHSRAEGSEAPWT
RHATGRLIRSETTPDFDLVAWPPPGAQPVDLAGAYPALDAQGYGYGPAFQGLRAAWRLGD
EVFAEVELPEDVDPAGYGLHPALLDAALHPVLVVESGEDKSPQLPFSWTGVSLFAEGARA
LRVRLTPTGGDGLAIRVADQAGAPVAQVADLLSREVVVPSAGVPDALFRIDWTKVEAAPT
TGKLLVLGDALGKYVPKVPDLASIGADVPEWVVLPIGSADTSRSAVDLALATAQEWLADD
RFASSRLVVLTRGGAAVGDVPVDPAVTAVHGLIRAAAAENPDRFALVDTDGWPVHWDGLL
AALGSGEPEVAVRGDDLLAPRLVRATPEGPAFAWTAEDTVLVTGGTGGLGAVLARHLVER
GVRQLVLTSRRGPDAPGATELVAELADLGATARVVACDVADRDSVAELLAGVDGLTAVVH
TAAVLDDGLVTGLTPERLDAAWNPKAEGARHLHELTGDLRAFVLFSSAAGVYDGAAQGNY
AAANTYVDGLAQARRAAGLPGVSLAWGFWSQRSGMTDHLSDVDLARMGRSGVTGLSTEEG
LALFDASLASAEPLLVPMRLDLAALRERDALPALLKSLVRKQVRRSGVTGEEDGGSALTR
RLRALPPADRTRVVLDLVRSHVAAVLGHDGAASVDPRRAFRDLGFDSLAAVELRNRLVAA
TGLRLPATLVFDHPNPELLAALLETELVGDAEPAADLPVAPTRAVDDDPIAVVGIGCRFP
GDVTTPEDLWRLLDGGVDAISAFPTDRGWDLDALFDPEPGKVGKSCSLEGGFLHDAADFD
AGFFGISPREALATDPQQRLLLETAWEALERAGIDPVSLRGSATGVFAGVMYNDYATRLR
SVPEDLAGYVGNGSLGSVASGRVSYVLGLEGPAVSVDTACSSSLVSLHLAAQALRAGECS
LALAGGVSVMATPDTFVDFSLQRGLAPGGRAKSFSADADGTAMSEGVGMLVLERLSDARA
NGHEVLAVLRGSAVNQDGASNGLTAPNGPSQQRVMRSALSVAGLRPSEVDAVEAHGTGTV
LGDPIEAQAVIATYGQDRAEPLWLGSIKSNIGHTQAAAGVAGVIKMIMAIRAGVLPRTLH
ADQRTDRVDWSGGAVELLTESRPWPETDHPRRAGVSSFGISGTNAHVIVEQAPTAPASTP
SGQDAPTRATPAPIVLAAADEGALRAQAENLLALLADGVDRTDLAHATATTRAALEHRAA
IVPGDPAEVLKSLEALATTGSGPGVVRGARSTGALALLFTGQGAQRAGMGRELRAAWPVF
AEAFDEACALLDAELDTPLAQVLDGDDPDLVQQTRYSQPALFAFEVALHRLLQSWGVRAD
LLAGHSIGELAAAHVAGVFSLADAARLVAARGRLMQSMRPDGGMVSVLATEERVRADLVG
LAGRVDVAAVNGPASTVVSGDADALADLVATWKAEGLKTRALAVSHAFHSPHTDEVLGAF
REVATTIAYAEPTTPVVSTLTGRLAEPGELTDPEYWVRHVRGAVRFHDAVRELESRGATT
FLEVGPDAVLTALGRDCLLDEAAALLTATQRADHPETTALAAAVGALFVRGANPDWAALF
AGSGARPVDLPTYPFQRRRYWLDATVGGVGSGAGHPLAGEVITTAEGDGVLLTGRLSPRT
HAWLADHTVSGEVLLPGTAFVELAVQAGDQVGCGRVEELTLQSPLVLPERGGVVLQVAVG
GPDESGRRTVTAHSRPDAEGAQWTRHATGSLVPDTTIATTDADLTGEPGRWAPPDATELD
LTGHYAELAARGYGYGPAFQGLRAAWRRGEEVFAEVALPEEVDASGYGLHPALLDATLHT
AELLEDGPGELTVPFAWKDVVLRATGASALRVRLTRTGPTAYSVALADPDGAPVAEVGSL
AVRPLPAAEGPSVGDALFRLDWTPVLGAADTPARLAVLGAPGRFPAEVAYPDLDAVAAAG
PQGPDSVLVPLRTTGDDPAAAGRAAVEGLLPVLRRWAEDERFAGKRLVVVTTGAVSVDGE
DSPGLAHAALWGLLRSAQVEHPDLVGVVDVDGDPASDLALPAALTAGEPQLAVRGGRAFV
PRLVRAGLPATAPDFGTGPVLVTGGLSGVGATVARHLVTARGVTELLLTSRRGQDAPGAA
ELVAELTGLGASVEVAACDVADRDAVAALLEGRELSAVVHSAGVVDDALLSGLTPEQVAA
VWRPKAEAAWRLHELTRGHDLTAFVLFSSLVSVVGGAGQSAYAAANGFLDALAAHRRSLG
LPATSVAWGLWTGVGSAMTGELGERDLRRMASSGVLGLRPAEGLALLDAAVASDRADLVA
ARLDLAAVRQASGAVPPVFRALVRGAVRRVAGTGAPTSGPSVAEQVAALPPARRRDHLVE
LVRGLVAGVLGHDGAHAVDAGKGFLELGFDSLAAVELRNRVAEVVGVRLSATLVYDHPTP
AAVAELLLSELGGAEESAPSLEAELARLETALETAAPDEEERVRVESRLRALVARWSGAG
GAVAEAADVLDAVTADELFDILDEELEATD
NT seq 21333 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcccgagaacgccgagcccgccaccaccgcagcgcccctggcgcggttggcc
gggctgccaccagcggagcaggagcgcgtcctgctcggcgtcgtgcacgagcaggtcgtc
gcggtgctgaaggccgccctgcccgacgcccccgaccgggtcgcccccgagcgccccttc
aaggagctgggcttcgactcgctggccgccgtggacctgcaccgcaggctgtccgccgcc
accggtctcgaactgccggtcaccctggtcttcgaccaccccaccccgctcgccgtggcc
cgcctcgcgcgccgcctggcgctgggcgagcgcgccgtgcccgtcgtgcgggagccggtc
gcgcggcgcgagcgggacgacgagcccatcgcggtcgtcggcatcggctgccgctacccc
ggcggcagcgacacccccgagaagctgtgggacgtcgtcgcgggcggcaggcacgtcatc
tccgacttccccgaggaccggggctgggacctggacgcgctgttcgaccccgagcccggc
aagcccggcaagtcctacgtgcgcaagggcggcttcctcaccgaggccgccgagttcgac
gccgcgttcttcggcatcagcccgcgcgaggccctggccatggacccgcagcagcgcctg
gtcctggagaccgcctgggaggccctggagcacgcgggcgtcgacccgctgtccctgcgc
ggcagccgcaccggcgtctacatcggcgtcgagccccaggagtacgggccgcgcctgcac
caggcccccgagggcctggacggctacctgctcaccggcaacgcgcccagcgtcgtctcc
gggcgcctggcctactcgctgggcctggaagggcccaccgtctcgatcgacaccgcctgc
tccggctcgctcgtggcgctgcacctcgcggtgcgggcgctgcgcgacggcgactgcacc
gccgcgctcgccggcggcgtcgcggtcatggtgcaccccggcgcgttcaccgcgttcagc
acccagcgcggcctcgcgcccgacggcgtgtgcaagcccttcgccgccgccgccgacggc
accggctgggccgagggcgtcggcgtggtcgtgctggagcggctgtccgacgcgctgcgc
gcgggccaccgcgtgctcggcgtgatcaagggcaccgccgtgaaccaggacggcgcctcc
aacggcctgaccgcgcccagcggtcccgcgcagcagcgcgtcatcctccaggccctcgcg
gacgccggtctgtccacttcggacgtcgacaccgtcgaggcgcacggcaccggcacgcgc
ctgggcgacccgatcgaggcgcaggcgctgctcgccacctacggccaggaccgcgagacc
ccgctgtggctgggctcgatcaagtccaacatcggccacagccaggccgccgcgggcgtc
gcgggcctgatcaaggtcgtgtacgcgatgcgcgagcgggtcctgccgcgcaccctgcac
gtggacgccccgagcccgcacgtggactggtcggcgggcgacatcgagctgctgaccgag
cagcgcccgtgggactcgcccgaccggccgcgccgcgcgggcatctcctcgttcggcgtc
agcggcaccaacgcgcacgtcgtgatcgaggagcccccggccgccccgccggtcgccccc
gccaagccggtcaaggcggccaaggccacccggaagtcccagaaggccaaggccgccgcg
cccgtcccggtgccgctgctgctctccggccggggcgaggccgcgctgcgcggccaggcc
acccggctcgccgagttcctcgccggtgacgccgccgccacccccgacctggtcgacacc
gcccacgagctggccctgcgccgcgccgccctggagcaccgcgcggtcctgcacgccacc
gaccgcgccgacgccctgcgcggcctggccgccctcgccgccgggcaggacgcccccggc
ctggtgcgcggcgccgccacggcgggcccgaccgcgttcctgttcaccggccagggcagc
cagcgcctgtcggcgggccgcgagctgtaccgcgcccacccggcgttcgccaaggccctg
gacgcggcctgcggctggctcgacctccagctcgaccgccccctcggcgaggtgatgttc
gccgagcccggcaccgaggccgccgcgctgctcgaccgcaccgcctacgcgcagagcgcc
ctgttcgccctggagaccgccctctaccggctggtcgagtcctggggcctgcgccccgac
tacgtcgcgggccactcgctgggcggcatcaccgccgcgcacgtcgcgggcgtgctgtcc
ctggaggacgccgcgctgctcgtcggcgcgcgcggcaggctcatgcaggcgctgcccgag
ggcggcgcgatggtgtcggtgcgcgcccccgagtccgaggtgctgccgctgctggagggc
cgcgaggccgaggtgcgcgtggccgccgtcaacgggcccgccgccaccgtgatctccggc
gtggagaccgccgtcctggaggtggcgggggtcctggccgaccggggcgtgaagaccaag
cggctcaccgtctcgcacgccttccactcgccgctgatggaaccggcgctcgccgacttc
cgccgcgtcgccgaggtcatgacctactccgcgcccaccatcccggtggtctccgacgtc
accggcgagctggccaccgccgagcagctgcggtccccggagtactgggtcgaccacgtc
cggcaggccgtccggttccgcgacgtggtcgccgagctcgccgcgcgcggcgtcgccacc
ttcctcgaactcggccccgacgccgtcctcaccgccatggcgcaggactgcgtggccgag
atcgacaccgacaccgacaccgacttcgccttcgccgccctgctgcgccgcgaccgcgac
gaggtcgccgaggtccgcgccgccgtcgccctggcgcacaccaggggccagtccgtgcgc
tgggccgagctgctgccccagggctccggcgcgcgcgtcgacctgccccgctacgccttc
cagcgcgagcgctactggctcaccggcggcagctccgcaggcggcgcggtcgagctgggc
cagctcgccgccgaccacccgctcgtcggcgccgtcgtcggcctcgcgggcggcgaccgg
gtcgtgctcaccggccgcgtctccccgcgcacccacccgtggctggccgaccacgtcatc
tccggctcggtcctgctgcccggcaccgcgttcgtggagctggccgtgcgcgcgggcgac
gaggtcggctgcgccgtgctcgaagagctgaccctggaagccccgctggtgctgcccgag
cgcggcggcgtcgtgctgcaggtcgtcgtggacgcccccgacgacggcggaaggcgcacc
gtggccgtgcactcgcggcccgagcacgcccccgaggacgcgggctggacccgccacgcg
ggcggcgtgctgtccgcgcaggccccggaaccgggcgagcgcctggagacctggccgccg
cgcgacgccgaaccggtcgacgcctccaccgcgtacgccgacctcgccgccctgggctac
ggctacggcccggtcttccagggcctgcgcaaggcgtggcggcgcgggaccggcccctcc
gccgaggtgtacgccgaggtggcgctgcccgagtcggtcgccgcgtccgccgcctccttc
ggcctgcaccccgccctgctcgacgccgccctgcacgccgtggacgtcgcgggaaccgcc
cccggcgaccccggcgaggtgcgcgtcccgttcgcctggaacgacgtcgtgctgcacgcc
accggcgcgtcggcggtgcgcgtgcgcatcagccccgccgggtccgacgcggtgtcgctg
accatcaccgacccggcgggcgcgcccgtggccgcggtcggctcgttcgtctcccgcgcg
gtcaccgccgagcagctcgccgccgcccgccgcgagcaccacgagtcgctgctgcgccag
gagtgggtctcgcggcccgtcccggccggccaggtccgcccggccgccgtgctcggcgcg
ggtcacgccgacctcgccgcgctgggcgccgccctcacctcgggcgcgaccgtgcccgag
accgtggtctaccacgtgccggtgagcaccggtgacgtgctggtcgacgtccgcgccgcg
ctggactcggtgctcaccgtggtccgccagtggctcgccgacgagcgcttcggcccgtcc
cgcctggtcgtggtcaccaggggcgtccgcgacgccgacctcgcgcacaccccggtgtgg
ggcctggtgcgcgccgcgcaggcggagaacccggaccgcttcaccctggtcgacctggac
gacgcccccgagtccgccgcgcagctgctcccggccgtcgccaccggcgagccggagctg
tccgtgcgcgacggcaaggtgtccgtgccgcgcctggcgcgcgtccccgtcgaggagccc
gccgccgacccgtgggcgggcgagggcaccaccctggtcaccggcgggaccggcggcctc
ggcgcgctggtcgccaagcacctggccaccaggggcgcccgccggctggtgctcaccagc
cgacgcggcccggacgcgcccggcgcggccgacctggtcgccgagctggccgacctcggc
gcgaccgcccgcgtggtggcctgcgacgtggccgaccgcgccgccgtcgccgacctcctg
gcaggcatcaccgacctgaccgccgtcgtgcacaccgccggtgtcgtcgcggacggcacg
gtcggcgccctcaccgccgagcgcgtggacgaggtgctgcgccccaaggccgacgccgcc
tggcacctgcacgagctcaccaggggccgcgacctgaccgcgttcgtcctgtactcctcg
ctggccgcgctgctcgacaaccccggccagggcaactacgccgccgcgaacctgttcctc
aacgcgctcgccgagcgccgccgcgccgagggcctgcccgccaccgccctcacctggggc
ctgtggctgggggagagcggcatgggctcggtgctcgacaccaccgccctgcaccgcatc
gaggcctccgggatgccgggcctgacccccgaggagaacctggcgctgctcgacgccgcg
ctcaccaccaccgagccggtgctcgccccggtccgcctcgacccgaccgcgctgcgcgcc
cgccccgacggcgtccccgccctgctgcgcgtcctggcccccaccgccgcgcgccgcgcc
gccgggggagcggcccagtccggcggcgacagcctcggcgcccggctggccgagctgccc
gaggccgaccgcgaccgcgtcctgctcgacctggtgcgcgcgcacgtcgcggccgtcctc
ggtcacggcggcggcgacgccatcgagcccaagcgcgcgttcagcgagatcggcttcgac
tcgctggcggccgtggagctgcgcaaccgcctcaccaccgccaccggcctgcggctgccc
gcgaccctggtgttcgactacccgaccccgctcgccctggtcgggcacctgaaggacaag
gcgctcggcgaccgcgccgccgccgctcccgtccagcgcgccaccgcgacggcggtggac
gacgagcccatcgccgtcgtcggcatgagctgccgcttccccggcggcgtcaccacgccc
gaggagctgtggcggctcgtcgccgacggcgtcgacggcatctcccgcttccccgacgac
cggggctgggacgtcgactcgctctacgaccccgagcccggcaagcccggccgcacctac
tcggtcgagggcggcttcctggacgacgcgctggacttcgacgccgagttcttcggcatc
agcccgcgcgaggccaccgcgatggacccgcagcagcgcctgctgctggagaccgcctgg
gaggccctggagcgcgcgggcatcgacccgacctcgctcaagggcagcccgaccggcgtg
ttcgcgggcatcatgtaccacgactacgccctgcggctgaaggacatcccggaggacctg
gccggttacctgggcaacggctcgctcgccagcgtcgcctccggccgggtgtcctacgtg
ctcggcctcgagggcccggcggtctcggtcgacaccgcctgctcctcgtcgctggtgtcc
atccacctcgccgcgcaggccctgcgcggcggcgagtgctcgctcgccctggccggtggc
gtcaccgtcatggccacgcccgacacgttcctggacttcagcctccagcgcggcctcgcc
gccgacggccggtccaagtcgttctccgccgacgccgacggcaccgcctggggcgagggc
gtgggcgtgctggtgctggagcggctgtccgacgcccgccgcaacgggcacgaggtcctg
gccgtggtcaagggctccgcgatcaaccaggacggcgcgtccaacggcctgaccgccccc
aacgggccgtcgcagcagcgggtcatccgggccgcgctgtccatggcgggcctgtcgcac
accgaggtcgacgccgtcgaggcgcacggcaccggcacccgcctgggcgacccgatcgag
gcgcaggcgctgctggccacctacggtcaggaccgcaccgagccgctgtggctgggctcg
atcaagtcgaacgtcggccacacccaggccgccgccggtgtcgcgggcgtgatcaagatg
gtcatggcgatgcgcgagggcgtgctgccgcgcaccctgcacgtgggggagcgcaccccg
caggtcgactggtccgagggcgcggtcgagctgctcacgcaggcccggccgtggccggag
accgggcgtccgcgccgcgcgggcgtctcgtcgttcggcatcagcggcaccaacgcgcac
gtcgtgctggagcaggcccccgccgccgaacccgtcgcacccgtcgagccggtcgagccg
cagtccgccgagtcgcagcccgtggagcagcggccgtccggcctggtgccctgggtgctg
tccgcccgcaccggggacgccctgcgcgagcaggccgcccggctgcgcgagcacgtcggc
tcggcgtccccgcgcgacgtcggctggtcgctggccaccacccgcgccgccctggagcgc
cgcgccgtcgtggtcggcgaggacgcaggccagctgggcgcgggcctgtccgcgctggcc
tccggcgaggccgccgcgtccgtcgtggacggcgaggcgctgtccgacccgagggtcgtg
ttcgtcttccccggccagggctcgcagtgggcgggcatggccgtggagctgctcgactcg
tccccggtgttcgccgagcggatgcgcgagtgcgccgccgccctgtccccgcacgtggac
tggaacctggtcgacgtcgtgcgcgacgcccccggcacgccgccgctgaaccgggtggac
gtgctccagccggtgctgtgggcgatcaccgtgtcgctggcggagctgtggaagcaccac
ggcgtgcgccccgacgcggtcgtcggccactcccagggcgagatcgccgccgccgtcgtc
tccggcgcgctgtccctgcaggacggcgccgcgatcgtcgcgctgcgcagcgtgctgatc
ggcgaggagctgtccggcaggagcgggatgctgtccatccagctgcccctggacgaggtc
ctgccgcgcctgcgcgggggactgaccatcggcgcgctcaacggcgcccgctcggtcgtg
gtctccggcgacccggagaacctggccgcgctccaggccgagctgaccgccgagggcgtg
cgcgcccgcccggtcaagatcgactacgcctcgcactccccgcacgtggaggtgatccgc
gagcggctgctggccgtgatcgcggacgtcgccccgcgcgccgccaccaccccgttctgc
tccaccgtcaccggcggcttcctcgacggggccacgctcgacgccgactactggtactcc
aacctgcgcgagaaggtcgacttcgtcggcgccacccgcgccctcctcggctccggccac
accgtgttcgtcgagtgcagcccgcaccccgtgctgccctcggccgtgcaggagaccgcc
gacgaggacgaccgcgaggtcgtcaccgtcccgaccctgcgccgcgaggacggcggcccc
cgcaggctgctgctgtccctggcccaggcgtggacgcgcggcgtcgacgtggactggacc
accctgctcaccggccccgccgccccgcgccgggtcgccctgcccacctacgccttccag
caccgccgcttctggctcgacgccaccgacggccccggcgacgtctcgtcggcgggcctg
ggcgccaccggccacccgctgctgggcgcgaccaccaccaccgccgggaacgacggcgtc
ctgctcaccggccgcctcgcgctcgacacccacccgtggctggccgaccacgccgcctcc
ggcgtcgtcctgctgcccggcaccgcgttcgtggagctcgcggtccgagccggtgaccag
gtcggctgcgaccgggtggacgagctgaccctggaggccccgctggtgctgcccgcgcgc
ggcggcaccgtcctgcaggtcgcggtcggcgcgcccgacgcgaccggcaggcgcgcggtg
agcgtgcactcccggcccgaggacgccgactcctcgtggacccggcacgcctccggcttc
ctggaccacgccccgcgcaccagccccgagcggctgaccgcgtggccgccgcccggcgcg
gcgaagctcgacgtcgacgccctctacgcggagctggcggcgggcggctacgcctacggc
ccggtgttccgcgccgtccgcgccgcctggcggcagggcgacgtggtgttcgccgaggtc
gcgctgcccgagcacgccgacgcggcgggcttcggcctgcacccggcgctgctcgacgcc
gcgctgcacgccaccggcgcccgcgagggcggggccgaggacggcctgatcgacctgccg
ttcgcctggaccggcgtcaccctgcacgcctccggcgcgaccgggctgcgcgtgcggctc
acccccgagggcggcggcgcggtgtcgctgctgctggccgacccgaccggcgcgccggtc
gccacggtcgacgcgctggtcacccggcccatcccggccgaggcgctgaccggcggctcc
ggccaggactcgctctaccgcgtggactggaccccggtcccggccgcgggcccggtcacc
ggccaggtcgtcgtgctggacggccccgacctgtccgcgctggagcaggtcccggactgg
gtggtgctgccggtctccggccaggccgcccgctccaccgtcgacgacgtgctctcggtg
ctgcgcgagtggatcgcggacgagcggttcgccgccgcccgcctcgccctggtcaccacc
ggcggcgtgcccgcggcgggccacgccgtcgacccggtcgtcgccccggtgtggggcctg
gtccgggccgcgcaggcggagaaccccgaccggttcgccctgctcgacctggacgtcgct
ctttcggacagccccgagaacctggcgggcgccgtcaccaccccgctcggcctcggcgag
cccgaggtcgcggtccggggcgacgcgctcctcgtgccgcgcttggcccgcgccaccgac
cgccctcgggccccgttcgcctggaccgccgaggacaccgtcctgatcaccggcggcacc
ggcggcctcggcgcgctgctcgcgggccacctggccgggcagggcgtgcggcagctggtg
ctcaccagccgacgcggcccggacgcccccggcgcgaccgagctggtggcgcggctggcc
gacctgggcgccaccgcccgcgtcgtcgcctgcgacgtcgccgaccgcgactcggtcgcc
gaactcctcgccgacgtcgacggcctcaccgccgtcgtgcacacggcgggcgcgctcgcc
gacggcctcgtctcggccatgacccccgagcaggtcgacgccgtctggctgcccaaggcc
gagggcgcgcgcaacctgcacgagctcacctcggacctcagggcgttcgtcgtcttctcc
tcggccgcgggcgtggtcgacggcaccggccagggcaactacgccgccgccaacacctac
ctcgacgcgctggtcgagcagcgccgcgccaccggtctgcccggcacctcgatcgcctgg
ggcctgtgggagcaccgcagcggcatgaccggccacctcaccgagggcgacctggcccgc
atggcccgctcgggcgtgcgcggcctgcccgccgccgagggcctggccctgttcgacgcc
gccctcgcgctcgacgccccgctgctggtcccggtgcgcctggacctggcggccctgcgc
accaggggcgaggagctgccccggctgttccacggcctggtccgccccacccgccgcgcc
gcgaccgccgcgggcgccgaccggaccccgcgcgacgagctgctcggcctgtccgccgag
gaccggggccgcgtcctgctcgacctggtccgctcgcacgtcgcggccgtcctcggccac
ggcagcggcgccgagatcgagccgcgccgcgcgttcggcgagctgggcttcgactcgctc
gcggcggtcgagctgcgcaaccggctcaccaccgccaccggcctgcggctgcccgccacc
ctggtgttcgaccacccgaccccggtcgccctggtcgcgcacctgtccgagtccctcggc
ggggccgcgcccagcgcgcccaccccggtggcggccacccgcgcggacgacggcgacccg
atcgccatcgtcgccatgggctgccgctaccccggcgacgtcaccacccccgaggagctg
tggaagctcgtcgcggacggcgtcgacgcgatcggcgggttccccgtcgaccggggctgg
gacaccgacggcatctacgaccccgaaccgggcaagcccggccgcacctacgtgcgcgag
ggcgggttcctgaacgacgccctgggcttcgacgccgggttcttcggcatctccccgcgc
gaggccctggccatggacccgcagcagcggctcctgctggagaccgcgtgggaggtcatc
gagcgggcgggcatcgacccgacctcgctcaagggcaccccgaccggcgtgttcgccggc
gtgatgtaccacgactacggcagcaggctgaaggaggtcccggaggacctggccggctac
ctgggcaacggcagcatcgccagcgtcctgtccggccgggtgtcctacgtgctcggcctc
gagggcccggcggtctccgtggacaccgcgtgctcctcgtcgctggtcaccatccacctg
gccgcgcaggcgctccgggcgggggagtgctcgctcgccctcgccggcggcgtcacggtg
atgtccgcgccggacaccttcgtggacttcagcctccagcgcggcctggcccgcaacggc
cggtccaagtcgttctcctcggacgccgacggcaccggctggggcgagggcgtcggcctg
gtcctgctggagcggctctccgacgcgcgccgcaacggccacgaggtgctcgcggtgctg
cgcggcagcgcggtcaaccaggacggcgcgtccaacggcctcaccgcgccgaacggcccg
tcgcagcagcgcgtcatccgcgcggcgctggccaacgcgggcctgtcgcacaccgaggtc
gacgccgtcgaggcgcacggcaccggcaccccgctcggcgacccgatcgaggcgcaggcg
ctgctggccacctacggccaggaccgggagatcccgctgctgctgggctccatcaagtcc
aacttcggccacacccaggcggcggcaggcgtcgcgggcgtcatcaagatggtcatggcg
atgcgggaggggcaggtcccggccaccctgcacgtctccgagcgcaccgaccaggtcgac
tggtccgagggcgcggtcgagctgctcaccgaggcgcgcccgtggccggagaccggccgc
ccgcgccgcgcgggcgtctcctcgttcggcatcagcggcaccaacgcgcacatcgtcctg
gagcaggcccccgagcccgccaccagggccgtccccgcgccggaagccgttgcgcccgag
gcgatcgagcccgacgccgccgtgcccaccggggcgctgctgcccctgccggtctccggt
cgcggcgcggacgcggtgcgcgcccaggccgggctgctcgccgcccacctggccgcccac
cccgacctcgcgccgctcgacgtcgcgcactccctggtcaccacccgcgccgcgctggag
cagcgcgccgtcgtggtcggcgaggacctggagcggctcaccgcgggcctgtccgcgctg
gcctccggcgaggccgccgcgtccgtcgtggacggtgaggtcctgtccgacccgagggtc
gtcttcgtcttccccggccagggctcgcagtgggtcggcatggccgccgagctgctcgac
gcctccccggtcttcgccgcccgcatggccgagtgcgcgcaggccctgtccgagttcgtg
gactgggacctgatcgcggtggcgcgcggcgacgaggacgccccctcgctggagcgggtc
gacgtcgtgcagccggtgctgtgggcgatgatggtgtcgctggccgagctgtggcgcgcg
aacggcgtgcgccccgacgcggtcgtcggccactcgcagggcgagatcgccgccgccgtc
gcgtccggcgcgctgtccacccgtgacggtgcggcgatcgtggcgctgcgcagcctcgcc
atcgccgaggacctggcgggcaagggcgggatgctgtccgtgcagctgcccgtggacgag
gtccgcccccggctggccgagggcctgtcgatcgcggtggtcaacggcgcccgctccgtc
gtggtctccggcgacccggccgggctggacgcgctccaggccgagctgcgcgccgagggc
gcgcgggccaagcgggtcccggtggactacgcctcgcactccgcgcacgtggagtcgatc
cgcgagcgcctgctcgacgtgctcgcggacctgtccccgcgcacctccaccaccccgttc
tgctccaccgtcaccgccgagttcaccgacaccacgacgctcgacgccggctactggtac
acgaacctgcgcgagacggtcgacttcgtcggcgccacccgcaccctgctcgccggcggg
cacgccgtgttcgtcgagtgcagcccgcacgcggtgctgacctcggcggtcctggagacc
gcggaggaggacggccgcgaggtcgccgcgatcggctcgctgcgccgcgacgacggcggc
ccccgccgggtgctgctgtccctggcccaggcgtggacgcgcggcgtcgacgtggactgg
accggcctgctcgcggaccgcgcgacggcggccggggcgaccccgaggcggatcgccctg
cccacctacgccttccagcaccgccgctactggctcgacgccacctcggcgaccggcgac
gtcacctcggcgggcctggccgcgaccgcgcacccgctgctcggcgcgaccatcgccgtg
gcgggcgcggacgaggtcctgctcaccggccgcctcgccgccgacacccacccgtggctg
gcgcaccacgccttcgcgggcaccaccctgctgcccggcaccgcgttcgtggaactcgcg
atccgggcgggcgaccaggtcggctgcgaccgcgtggacgagctgaccctggaggccccg
ctggcgctgcccgagcgcggcggcgtgcacgtccagctccgcatcggcgaccccgaccgg
gacggcggccgggagctgaccgtgcactcccgcgccgagggctccgaggccccgtggacc
cggcacgccaccggccgcctgatccgctccgagaccaccccggacttcgacctggtggcc
tggccgccgcccggcgcgcagccggtggacctggcgggcgcctacccggcgctcgacgcc
cagggctacggctacggccccgcgttccaggggctgcgcgccgcctggcgcctcggcgac
gaggtgttcgccgaggtcgagctgcccgaggacgtggacccggcgggctacggcctgcac
cccgcgctgctcgacgccgcactgcacccggtgctggtcgtggagtccggtgaggacaag
tcgccgcagctgccgttctcctggacgggtgtgtcgctgttcgccgagggcgcccgcgcc
ctgcgggtgcggctcaccccgaccggcggcgacggcctggccatccgggtcgccgaccag
gcgggcgcccccgtcgcccaggtcgccgacctgctctcccgcgaggtcgtcgtgccctcg
gccggtgtgccggacgcgctgttccgaatcgactggaccaaggtcgaggccgcgccgacc
accggcaagctgctcgtgctcggcgacgcgctcggcaagtacgtgcccaaggtccccgac
ctggcctcgatcggcgcggacgtcccggagtgggtcgtgctgccgatcggctcggccgac
acctcccgctccgctgtcgacctggccctggccaccgcgcaggagtggctggccgacgac
cggttcgcctcgtcgaggctcgtggtgctcaccaggggcggcgcggcggtcggcgacgtg
ccggtcgacccggccgtcaccgccgtgcacggcctgatccgggccgccgccgccgagaac
cccgaccggttcgcgctggtggacaccgacggctggccggtgcactgggacgggctgctc
gccgcgctgggctccggtgagccggaggtcgcggtgcgcggcgacgacctgctcgccccg
cgcctggtccgcgccacccccgagggccccgcgttcgcctggaccgccgaggacaccgtc
ctggtcaccggcggcaccggcggcctcggcgcggtgctggccaggcacctggtggagcgg
ggcgtgcggcagctggtgctcaccagccgccgcggccccgacgcccccggcgcgaccgag
ctggtggcggagctggccgacttgggcgccaccgcccgcgtcgtcgcctgcgacgtcgcc
gaccgcgactcggtcgccgaactcctggcgggcgtcgacggcctcaccgccgtcgtgcac
accgccgccgtgctcgacgacggcctcgtcaccggcctgacccccgagcggctcgacgcc
gcctggaaccccaaggccgagggcgcgcggcacctgcacgagctgaccggcgacctgcgg
gcgttcgtgctgttctcctcggcggcgggcgtctacgacggcgccgcccagggcaactac
gccgccgccaacacctacgtcgacggcctcgcgcaggcccgccgcgccgcggggctgccg
ggcgtctcgctcgcctggggcttctggtcccagcgcagcggcatgaccgaccacctgtcc
gacgtggacctggcccgcatgggccgctccggcgtcaccggcctgagcaccgaggagggc
ctcgcgctgttcgacgcgagcctcgcctcggccgagccgctgctggtgccgatgcgcctc
gacctggccgcgctgcgcgagcgcgacgcgctgcccgcgctgctgaagtccctggtgcgc
aagcaggtccgccgctccggcgtcacgggcgaggaggacggcggctccgcgctgacccgc
aggctccgcgcgctgcccccggccgaccggacccgcgtggtgctggacctggtgcgctcg
cacgtcgcggccgtcctcggccacgacggcgcggcgtccgtcgacccgcgccgcgcgttc
cgcgacctgggcttcgactcgctcgccgcggtcgagctgcgcaaccgcctggtcgcggcc
accggcctgaggctgcccgcgaccctggtgttcgaccacccgaacccggagctgctggcg
gccctgctggagaccgagctggtcggcgacgccgagcccgccgccgacctgccggtcgcg
cccacccgcgcggtggacgacgacccgatcgcggtcgtcggcatcggctgccgcttcccc
ggcgacgtcaccacgcccgaggacctgtggcggctgctcgacggcggcgtcgacgccatc
agcgcgttcccgaccgaccggggctgggacctggacgccctgttcgacccggagcccggc
aaggtcggcaagtcctgctccctggagggcggcttcctgcacgacgcggccgacttcgac
gccgggttcttcggcatcagcccgcgcgaggccctcgccaccgacccgcagcagcgcctg
ctgctggagaccgcgtgggaggccctggagcgggccgggatcgacccggtgtcgctgcgc
ggcagcgccaccggcgtgttcgcgggcgtgatgtacaacgactacgcgacccgcctgcgg
tcggtgcccgaggacctggcgggctacgtcggcaacggcagcctgggcagcgtcgcgtcc
ggccgggtgtcctacgtgctgggcctggaaggcccggccgtctcggtcgacaccgcgtgc
tcctcctcgctggtctccctccacctggccgcgcaggcgctcagggcgggggagtgctcg
ctggcgctggcgggcggcgtgagcgtcatggccacgccggacacgttcgtcgacttcagc
ctccagcgcggcctggcgccgggcgggcgggcgaagtcgttctccgccgacgcggacggc
accgcgatgtccgagggcgtcgggatgctggtcctggagcggctctccgacgcgcgggcc
aacgggcacgaggtgctggcggtgctgcgcggcagcgcggtcaaccaggacggcgcgtcc
aacggcctcaccgcccccaacgggccgtcgcagcagcgggtcatgcggtccgcgctgtcc
gtcgcgggcctgcgaccgtccgaggtggacgccgtcgaggcgcacggcaccggcacggtg
ctcggcgacccgatcgaggcccaggccgtcatcgccacctacggccaggaccgcgccgag
ccgctgtggctgggctcgatcaagtccaacatcggccacacccaggcggcggcgggcgtc
gcgggcgtcatcaagatgatcatggcgatccgggcgggcgtgctgccccgcacgctgcac
gccgaccagcgcaccgaccgggtcgactggagcgggggcgcggtcgagctgctgaccgag
tcccggccgtggccggagaccgaccacccgcgccgcgcgggcgtctcctccttcggcatc
agcggcaccaacgcgcacgtcatcgtcgagcaggccccgaccgcaccggcatcgacccct
tccggccaggacgcgcccaccagggcgacgcccgccccgatcgtgctggccgccgccgac
gagggcgccctgcgcgcccaggcggagaacctgctcgcgctgctcgccgacggcgtcgac
cggaccgacctggcccacgccaccgccaccacccgcgcggccctggagcaccgcgcggcg
atcgtccccggcgaccccgccgaggtgctcaagtccctggaagccctggccaccaccggt
tccggtccgggcgttgtgcgcggcgcccgctccaccggggcgctcgccctgctgttcacc
ggtcagggcgcccagcgcgcgggcatggggcgcgagctgcgcgccgcctggccggtgttc
gccgaggcgttcgacgaggcgtgcgcgctgctcgacgccgagctggacaccccgctcgcg
caggtcctggacggcgacgacccggacctggtgcagcagacccgctacagccagcccgcc
ctgttcgccttcgaggtcgccctccaccgcctgctccagtcctggggcgtgcgcgcggac
ctcctcgcgggccactcgatcggcgagctggccgccgcccacgtcgccggggtgttctcc
ctggccgacgcggccaggctggtcgccgcgcgcggcaggctcatgcagtccatgcgcccc
gacggcggcatggtctcggtcctggccaccgaggagcgcgtccgcgccgacctcgtgggc
cttgcgggccgggtcgacgtcgccgccgtgaacggccccgcctcgaccgtcgtctccggc
gacgccgacgcgctggccgacctcgtggcgacctggaaggccgagggcctcaagacccgc
gcgctcgcggtgtcccacgccttccactccccgcacaccgacgaggtgctgggcgcgttc
cgcgaggtcgccacgaccatcgcctacgccgagccgaccacccccgtcgtctccaccctc
accggccgcctcgccgaaccgggcgagctgaccgaccccgagtactgggtgcggcacgtg
cgcggcgcggtgcgcttccacgacgccgtgcgggagctggagtccaggggcgccaccacg
ttcctggaggtcggcccggacgcggtgctcaccgcgctcggccgcgactgcctgctcgac
gaggccgccgcgctgctgaccgccacccagcgcgccgaccacccggagaccaccgcgctc
gccgccgccgtgggcgcgctgttcgtccggggcgccaacccggactgggccgcgctgttc
gccggctccggagcccgaccggtcgacctgcccacctacccgttccagcgccgccgctac
tggctcgacgccaccgtcggcggcgtcggctcgggcgcaggccacccgctggcgggcgag
gtgatcaccaccgccgagggcgacggggtcctgctcaccggcaggctctccccccgcacc
cacgcgtggctggccgaccacaccgtctcgggcgaggtcctgctgcccggcacggcgttc
gtggagctggccgtccaggcgggcgaccaggtcggctgcggccgggtcgaggagctgacc
ctccagtccccgctcgtgctccccgagcgcggcggcgtcgtgctccaggtcgccgtgggc
ggcccggacgagtccggccgccgcacggtcaccgcgcactcccggcccgacgccgagggc
gcgcagtggaccaggcacgccaccggctcgctcgtcccggacaccacgatcgccaccacc
gacgccgacctgaccggcgagcccggccggtgggcgcccccggacgccaccgagctggac
ctcaccgggcactacgcggagctggccgcgcgcggctacggctacggcccggcgttccag
ggcctgcgcgcggcctggcggcgcggcgaggaggtgttcgccgaggtcgccctgcccgag
gaggtcgacgcctccggctacggcctgcacccggccctgctggacgccaccctgcacacc
gccgagctgctggaggacgggcccggcgagctgaccgtgccgttcgcctggaaggacgtg
gtgctgcgggccaccggggcgtccgcgctgcgggtccgcctgacccgcaccggccccacc
gcctactcggtcgcactggccgacccggacggcgcgccggtcgccgaggtgggctcgctg
gcggtgcgcccgctgcccgccgccgagggcccctcggtcggcgacgcgctgttccggctc
gactggaccccggtgctcggcgcggccgacaccccggccaggctcgccgtgctcggcgcg
ccgggccgcttcccggccgaggtcgcctacccggacctggacgcggtggcggcggcgggc
ccgcagggaccggactcggtcctggtgcccctgcgcaccaccggcgacgacccggccgcg
gccggacgggcggcggtcgaggggctgctgccggtgctgcggcgctgggccgaggacgag
cggttcgcgggcaagcggctcgtggtcgtcaccaccggcgcggtgtcggtggacggcgag
gactcgccgggcctggcgcacgccgccctgtgggggctgctgcgctccgcccaggtcgag
cacccggacctggtgggcgtggtcgacgtggacggcgaccccgcctccgacctggccctg
cccgccgccctgaccgccggggagccgcagctcgcggtgcgcggcggccgggcgttcgtg
cccaggctggtccgggccgggctgcccgcgacggcgcccgacttcggcacgggcccggtg
ctggtcaccggcggcctgagcggcgtcggcgcgaccgtcgcccggcacctggtcaccgcg
cgcggcgtcaccgagctgctgctcaccagccgtcgcggccaggacgcgcccggcgcggcc
gagctggtcgcggagctgaccggcctcggcgcctcggtcgaggtcgccgcgtgcgacgtc
gccgaccgcgacgccgtcgccgccctgctggagggccgggagctctcggcggtcgtgcac
tcggcgggcgtcgtcgacgacgcgctgctgtccgggctcacccccgagcaggtggcggcg
gtctggcggcccaaggccgaggccgcctggcgcctgcacgagctgacgcggggccacgac
ctgaccgcgttcgtgctgttctcctcgctggtctcggtcgtcggcggcgcgggccagtcc
gcctacgccgcggccaacggcttcctcgacgcgctcgccgcgcaccgccgctccctgggc
ctgcccgccacctcggtggcgtggggcctgtggaccggggtgggcagcgcgatgaccggg
gagctgggggagcgggacctcaggcgcatggcgtcctccggggtgctgggcctgcggccc
gccgaggggctggcgctgctcgacgcggcggtggcctcggaccgggccgacctcgtggcg
gccaggctggacctggcggccgtgcggcaggcgtccggcgcggtgcccccggtgttccgg
gcgctggtgcgcggggcggtcaggcgggtcgccgggaccggcgcgcccacctcggggccg
tcggtggccgagcaggtcgccgcgctgcccccggccaggcggcgcgaccacctcgtggag
ctggtgcgcgggctggtggcgggcgtcctcgggcacgacggggcgcacgcggtcgacgcg
ggcaagggattcctggaactgggcttcgactcgctcgccgcggtcgagctgcgcaaccgg
gtggccgaagtggttggggtccggttgtccgcgacgctggtctacgaccacccgacgccc
gccgccgtggccgagctgctgctgtccgaactgggcggtgcggaggagtccgcgccctcc
ttggaggccgagctcgcccggttggagaccgccttggagaccgccgcgccggacgaggag
gagcgcgtccgggtggagagcaggctgcgcgcgctggtggcgcgctggtctggcgcaggt
ggggcggtggccgaggcggccgacgtgctggacgcggtgaccgccgacgagctgttcgac
atcctggacgaggagctggaagcgaccgattga

DBGET integrated database retrieval system