KEGG   Actinosynnema mirum: Amir_3141
Entry
Amir_3141         CDS       T00957                                 

Definition
(GenBank) deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
ami  Actinosynnema mirum
Pathway
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    Amir_3141
Enzymes [BR:ami01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     Amir_3141
SSDB
Motif
Pfam: DeoC Zeta_toxin
Other DBs
NCBI-ProteinID: ACU37053
UniProt: C6W832
LinkDB
Position
3627477..3628262
AA seq 261 aa
MTPFRTFARQLRIRRMHQHGGPRLLLVPLEQPAAGCGSLARTVAEVIDGGADAVVLHKGL
LRHVHPESFTSASLVVNLSASTKHAPDSTHLVAHVEEAVRLGADAVCVSVDFGSDGENRQ
IADLATVAEECDRWNVPLLASVHPRGPEQGSPELLARAAGLAVDLGADLVELPPVADHAA
QADVIAGCAIPVLIAVTHHRVDAETVAEARRALAAGSGGITAGQAVADSGDPAALARVLA
NVVHADAPRGIPSARSRPHGV
NT seq 786 nt   +upstreamnt  +downstreamnt
gtgacgcccttccgcacgttcgcccggcagctccgcatcaggcggatgcaccagcacggc
ggcccccgcctgctgctcgtccccctggagcagcccgccgcgggctgcggcagcctggcg
cggaccgtcgccgaggtgatcgacggcggcgcggacgcggtggtgctgcacaaggggctg
ctgcggcacgtgcaccccgagtcgttcacctccgcctcgctggtggtgaacctcagcgcc
agcaccaagcacgcccccgactccacgcacctggtcgcgcacgtggaggaggcggtgcgg
ctgggcgcggacgcggtgtgcgtgagcgtcgacttcggctcggacggcgagaaccggcag
atcgcggacctggccaccgtcgccgaggagtgcgaccggtggaacgtgccgctgctggcg
tcggtgcacccgcgcggccccgagcagggctcgccggagctgctggcccgcgccgccggg
ctcgccgtcgacctcggcgcggacctggtggagctgccgccggtcgccgaccacgcggcg
caggccgacgtgatcgccgggtgcgccatcccggtgctgatcgcggtcacccaccaccgg
gtggacgcggagaccgtcgccgaggcgcggcgcgcgctggccgcggggtccggtggcatc
acggccgggcaggcggtcgcggactcgggcgaccctgcggcgctggcgcgcgtgctggcg
aacgtggtccacgccgacgccccgcgcggcatcccgtccgcccgcagccgcccgcacggg
gtctga

DBGET integrated database retrieval system