KEGG   Actinosynnema mirum: Amir_4256Help
Entry
Amir_4256         CDS       T00957                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ami  Actinosynnema mirum
Pathway
ami00473  D-Alanine metabolism
ami00550  Peptidoglycan biosynthesis
ami01100  Metabolic pathways
ami01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Amir_4256
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Amir_4256
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Amir_4256
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ami01011]
    Amir_4256
Enzymes [BR:ami01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Amir_4256
Peptidoglycan biosynthesis and degradation proteins [BR:ami01011]
 Precursor biosynthesis
  Amino acid ligase
   Amir_4256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ACU38111
UniProt: C6WIM1
LinkDB All DBs
Position
complement(5014057..5015076)
Genome map
AA seq 339 aa AA seqDB search
MLRVLHLTGSPVSPFFAELSTVYGRGCLGAAADPARYEFLVAHVTPDGRWRFPADLTPEA
LAAAPRLGLPEALGLIESRSVDVAVPQLFCPPGMTTYRALLDALGVPYPGNPPDVMALGA
DKAMTRAVVAAAGVPVPEGRVVTSADPCPLPPPFVVKPVDADNSDGLTLVHDRADYHAAL
DAAFACSPRRRALVERYVPPGREVRCGVLVRSGVPTPLPLEEYPLPSGVRPRADKLADDG
GGSLSLVAKADGRSWIVDHDDPVTAAVQEQALRCHEALGCRDYSLFDFRIDPEGRPWFLE
AGLYCSFAPTSVITTMAGAAGIGLAELFAEAVTTAARRG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcgtgttctgcacctgaccggttcgccggtgagcccgttcttcgccgaactgtcc
actgtgtacggtcggggctgcctgggcgcggcggcggacccggcgcgctacgagttcctg
gtggcgcacgtgaccccggacggccgctggcgcttcccggcggacctgacgccggaggcg
ctggcggctgcacccaggctggggctgcccgaggcgctgggcctgatcgaatcccggtcg
gtggacgtggccgtgccgcagctgttctgcccgcccggcatgaccacgtaccgcgcgctg
ctggacgccctgggcgtgccgtaccccggaaacccgccggacgtgatggcgctgggcgcg
gacaaggcgatgacccgcgcggtcgtggcggcggcgggcgtccccgtcccggagggccgc
gtggtcacctcggccgacccctgcccgctcccgccgccgttcgtggtgaagcccgtggac
gccgacaactccgacggcctgaccctggtgcacgaccgcgccgactaccacgcggccctg
gacgcggcgttcgcctgctcgccccgccgcagggccttggtggagcgctacgtgccaccg
ggccgcgaggtccgctgcggcgtgctcgtcagatccggcgtcccgacgccgctccccttg
gaggagtacccgctcccgtccggcgtccgcccccgcgcggacaagctggccgacgacggg
ggcggctccctgtccctggtggccaaggcggacggccgctcgtggatcgtcgaccacgac
gacccggtgacggcggccgtgcaggagcaggcgctgcgctgccacgaggcgctgggctgc
cgcgactacagcctgttcgacttccggatcgacccggaggggcggccgtggttcctggag
gcggggttgtactgctcgttcgcgccgacgagcgtgatcacgacgatggcgggcgcggcg
gggatcgggttggcggagctgttcgccgaggccgtcaccaccgccgcgcgcagggggtga

DBGET integrated database retrieval system