KEGG   Actinosynnema mirum: Amir_6035Help
Entry
Amir_6035         CDS       T00957                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ami  Actinosynnema mirum
Pathway
ami00970  Aminoacyl-tRNA biosynthesis
ami01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ami00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Amir_6035
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ami03029]
    Amir_6035
Enzymes [BR:ami01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Amir_6035
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Amir_6035
Mitochondrial biogenesis [BR:ami03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Amir_6035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ACU39842
UniProt: C6WG78
LinkDB All DBs
Position
complement(7087156..7087455)
Genome map
AA seq 99 aa AA seqDB search
MPSISRDEVAHLARLARLAVTDDELDLFAGQLDVILQSVATVGDIATADIPPTSHAVPLT
NVFREDVVRPSLGQQQALAGAPAAEEGRFRVPRILGEEA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagcatctcccgcgacgaggtcgcgcacctggcccgcctggccaggctcgccgtc
accgacgacgagcttgacctcttcgcaggccagcttgacgtgatcctgcagtcggtggcc
acggtgggcgacatcgccaccgctgacatcccacccacttcgcacgccgtaccgctgacc
aacgtgttccgcgaggacgtggtgcgtcccagcctcggtcagcagcaggcgctcgcgggc
gcccccgccgccgaggaaggccgcttccgcgtcccgcgcattctcggtgaggaagcatga

DBGET integrated database retrieval system