KEGG   Actinosynnema mirum: Amir_6282Help
Entry
Amir_6282         CDS       T00957                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ami  Actinosynnema mirum
Brite
KEGG Orthology (KO) [BR:ami00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Amir_6282
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Amir_6282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: ACU40086
UniProt: C6WJ10
LinkDB All DBs
Position
7371115..7371531
Genome map
AA seq 138 aa AA seqDB search
MRLLSRIRELHRAIPEATAHCDLPCGVYDPAQARIEAESIKAVQEKYQANEDPEFRQRAV
LIKEQRSELVKHHLWVLWTDYFKAPHFEKYPQLHDLFNRATKAAGASGTKGNMDPATGQQ
LLDLIAEIDKIFWETKQA
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttctgtcgcgcatccgtgaactccaccgcgcgatcccggaggccaccgcgcac
tgcgacctcccgtgcggtgtctacgacccggcacaggccaggatcgaagcggagtccatc
aaggcggtccaggagaagtaccaggccaacgaggacccggagttccgccagcgcgccgtg
ctgatcaaggagcagcgcagcgaactggtgaagcaccacctgtgggtgctgtggaccgac
tacttcaaggcgccgcacttcgagaagtacccgcagctgcacgacctgttcaaccgcgcc
accaaggccgcgggcgcgtcgggcaccaagggcaacatggacccggcgacgggccagcag
ctgctggacctgatcgcggagatcgacaagatcttctgggagaccaagcaggcgtga

DBGET integrated database retrieval system