KEGG   Actinosynnema mirum: Amir_6478Help
Entry
Amir_6478         CDS       T00957                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ami  Actinosynnema mirum
Pathway
ami00020  Citrate cycle (TCA cycle)
ami00480  Glutathione metabolism
ami01100  Metabolic pathways
ami01110  Biosynthesis of secondary metabolites
ami01120  Microbial metabolism in diverse environments
ami01130  Biosynthesis of antibiotics
ami01200  Carbon metabolism
ami01210  2-Oxocarboxylic acid metabolism
ami01230  Biosynthesis of amino acids
Module
ami_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ami_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ami00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Amir_6478
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Amir_6478
Enzymes [BR:ami01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Amir_6478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: ACU40279
UniProt: C6WKM8
LinkDB All DBs
Position
complement(7614279..7615499)
Genome map
AA seq 406 aa AA seqDB search
MGKIKVQGTVVELDGDEMTRIIWQFIKDKLVHPYLDVNLEYYDLGIEHRDATDDQVTIDA
ANAIKKHNVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWTKPIIIGRHAHGDQYKATNFKVPGAGKLTVTFTPEDGSAPIEHVVANYGADGGVAM
GMYNFNKSIEDFARASFSYGLQRNYPVYMSTKNTILKAYDGAFKDIFQQVFEAEFKAEFD
AKGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHFRQHQAGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVTGFAETLE
KVIIETVESGKMTKDLALLVGRDQEWQTTEDFLATLDENLQKKMAG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggttcaggggactgtcgtcgagctcgacggcgacgagatgaccagg
atcatctggcagttcatcaaggacaagctggtccacccgtacctggacgtcaacctcgag
tactacgacctgggcatcgagcaccgggacgccaccgacgaccaggtcaccatcgacgcg
gccaacgcgatcaagaagcacaacgtgggcgtgaagtgcgccaccatcacgccggacgag
gcgcgggtggaggagttcggcctcaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctcggcggcgtggtcttccgcgagccgatcatcatctcgaacatcccccggctc
gtccccggctggaccaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gccacgaacttcaaggtccccggcgcgggcaagctgaccgtgaccttcacgcccgaggac
ggctccgcgccgatcgagcacgtcgtcgccaactacggcgccgacggcggcgtggccatg
ggcatgtacaacttcaacaagtccatcgaggacttcgcgcgggcctcgttctcgtacggc
ctgcagcggaactacccggtgtacatgtcgaccaagaacaccatcctcaaggcgtacgac
ggcgccttcaaggacatcttccagcaggtgttcgaggccgagttcaaggccgagttcgac
gccaaggggctcacctacgagcaccgcctcatcgacgacatggtcgccgcggccatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggcgacgtgcagtccgacacg
gtcgcgcagggcttcgggtcgctcggcctgatgacctccgtgctgatgaccccggacggc
aagaccgtcgaggccgaggccgcgcacggcaccgtcacccggcacttccgccagcaccag
gcgggcaagccgacctccaccaacccgatcgcgtcgatcttcgcctggaccggtggcctt
aagcaccgcggcaagctcgacgggacccccgaggtcaccgggttcgcggagacgctggag
aaggtcatcatcgagaccgtcgagagcggcaagatgacgaaggacctcgcgctgctggtc
ggtcgtgaccaggagtggcagaccacggaggacttcctcgccacgctggacgagaacctc
cagaagaagatggcgggctga

DBGET integrated database retrieval system