KEGG   Actinosynnema mirum: Amir_6818Help
Entry
Amir_6818         CDS       T00957                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ami  Actinosynnema mirum
Pathway
ami02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ami00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Amir_6818
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ami02000]
    Amir_6818
Enzymes [BR:ami01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Amir_6818
Transporters [BR:ami02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Amir_6818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_30 AAA_16 AAA_29 Rad17 RsgA_GTPase AAA_33 AAA_15 AAA_18 AAA_23 AAA_28 AAA AAA_25 PRK RNA_helicase
Motif
Other DBs
NCBI-ProteinID: ACU40614
UniProt: C6WPR3
LinkDB All DBs
Position
complement(7959603..7960379)
Genome map
AA seq 258 aa AA seqDB search
MAKRIDVKDLNLYYGKFHAVNEVSLAVPPRSVTAFIGPSGCGKSTVLRSLNRMHEVAPGA
RVEGKVLLDGEDIYASSVDPVQVRRTIGMVFQRPNPFPTMSIRDNVVAGLRLAGVKNRKQ
LDEVAERSLRGANLWNEVKDRLDRPGGGLSGGQQQRLCIARAIAVQPDVLLMDEPCSALD
PISTLAIEDLITELKKDFTIVIVTHNMQQAARVSDQTAFFNLLGVGQPGRLIEVDDTEKI
FSNPTQKATEDYISGRFG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgcatcgacgtcaaggacctcaacctctactacggcaagttccacgccgtg
aacgaggtctccctagccgttccgccgcgcagcgtgaccgcgttcatcggcccgtccggc
tgcggcaagtccaccgtgctccgctcgctgaaccggatgcacgaggtggcgcccggcgcc
cgcgtcgagggcaaggtgctgctggacggcgaggacatctacgcctcctcggtcgacccg
gtgcaggtgcgccgcaccatcggcatggtgttccagcgccccaacccgttcccgacgatg
tccatccgcgacaacgtcgtggcgggcctgcgcctggcgggcgtgaagaaccgcaagcag
ctcgacgaggtcgcggagcgctcgctgcgcggcgcgaacctgtggaacgaggtcaaggac
cgcctcgaccggccgggcggcggcctgtcgggcggtcagcagcagcgcctgtgcatcgcg
cgcgccatcgccgtccagccggacgtgctgctgatggacgagccctgctcggccctggac
ccgatctccacgctggcgatcgaggacctgatcacggagctgaagaaggacttcaccatc
gtgatcgtcacccacaacatgcagcaggcggcgcgcgtcagcgaccagaccgcgttcttc
aacctgctcggcgtgggccagcccggcaggctgatcgaggtggacgacaccgagaagatc
ttctcgaaccccacccagaaggccaccgaggactacatctcgggccgcttcggctga

DBGET integrated database retrieval system