KEGG   Aminipila sp. CBA3637: Ami3637_11550
Entry
Ami3637_11550     CDS       T06414                                 

Gene name
pylD
Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
amic  Aminipila sp. CBA3637
Pathway
amic00300  Lysine biosynthesis
amic01100  Metabolic pathways
amic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Ami3637_11550 (pylD)
Enzymes [BR:amic01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Ami3637_11550 (pylD)
SSDB
Other DBs
NCBI-ProteinID: QHI72953
UniProt: A0A6P1MID1
LinkDB
Position
2441921..2442733
AA seq 270 aa
MTRLRTEWIEYMLDGMEEYNKQLKIKTGMDLADFIKDTFNMQEAVFQQARDTKKIAVVPI
TQGEGIISSFSESVAAIIKSIGFNALVTEHTDIDGIYEGTEKGCDIFFFADDARYLALNI
KSGNVCDNNYATALGFIKVLKALMNKNGKNIREEKILQIGYGIVGRESEKILLQDKINFD
IFDKNLDVIKELPYEKLTEKDQIRNYNYIVDFTNEGGWLKKECLSPDLLYVSPGVPYSMD
SEAEAYFENRAVHDNLEIGTAIMLGRVIAD
NT seq 813 nt   +upstreamnt  +downstreamnt
atgaccagattgaggacagaatggattgaatatatgctggatggcatggaagaatacaat
aaacagctgaaaatcaaaacaggtatggatttagctgatttcatcaaagacacatttaat
atgcaggaagcagttttccaacaggcaagagatactaaaaagattgcagtggttcccatt
acccagggtgaaggcattataagctctttcagtgaatccgtagccgctatcattaaatcc
ataggatttaatgctttagtaacagaacatacagatatagatggcatctatgaaggtact
gaaaaaggttgtgacatattcttttttgcggatgatgcaagatatctggctttaaatata
aaaagtggaaatgtttgtgataataactatgctacagcattaggatttatcaaggtactt
aaggctttaatgaataaaaatgggaaaaacatccgtgaagaaaaaattcttcagattggt
tatggaattgtaggcagagaatcagagaaaatcttgttacaagacaaaataaactttgat
attttcgataaaaacttggatgtaattaaagaattaccatatgaaaaattaacagagaaa
gatcagatcaggaattacaattatatagtagactttaccaatgaagggggctggctgaaa
aaagagtgtctcagcccagatcttttgtatgtaagtccaggggtaccatattccatggat
agtgaagctgaagcgtattttgagaacagagcggttcacgacaatcttgaaataggaact
gccattatgttgggaagggttattgctgattaa

DBGET integrated database retrieval system