KEGG   Aminobacter sp. MSH1: CO731_00011Help
Entry
CO731_00011       CDS       T05420                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00061  Fatty acid biosynthesis
amih01100  Metabolic pathways
amih01212  Fatty acid metabolism
Module
amih_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CO731_00011 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amih01004]
    CO731_00011 (fabA)
Enzymes [BR:amih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CO731_00011 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CO731_00011 (fabA)
Lipid biosynthesis proteins [BR:amih01004]
 Fatty acid synthase
  Component type
   CO731_00011 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AWC20571
UniProt: A0A2S0XC00
LinkDB All DBs
Position
9518..10039
Genome map
AA seq 173 aa AA seqDB search
MADQKSSYGYEELLACARGELFGPGNAQLPAPPMLMFDRITEISETGGEFDKGFVRAEFD
IKPDLWFFPCHFIGNPIMPGCLGLDAMWQLTGFFLGWLGESGKGMALSTGEVKFKGMVTP
SVKKVEYGIDFKRVMRGRLVLGIADGWLKADGEPIYKATDLKVGLSKQEASAV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcagaaatccagctacggctacgaagaattgctggcatgtgcccgcggtgag
ctgttcggacccggcaatgcccagctgccggccccgccgatgctgatgttcgatcgcatc
accgagatcagcgagaccggcggcgagttcgacaagggcttcgtccgcgccgaattcgac
atcaagccggacctttggttcttcccctgccacttcatcggcaatcccatcatgccgggc
tgcctcggcctcgacgccatgtggcagctgactggcttcttcctcggctggctcggcgag
tccggcaagggcatggcgctctctaccggcgaggtgaagttcaagggcatggtcactcct
tcggtgaagaaggtcgaatacggcatcgacttcaagcgcgtcatgcgcggccgcctggtg
ctcggcattgccgatggctggctgaaggctgacggcgaacctatctacaaggctaccgac
ctgaaggtcgggctctcgaagcaggaagcctcggccgtctga

DBGET integrated database retrieval system