KEGG   Aminobacter sp. MSH1: CO731_00013Help
Entry
CO731_00013       CDS       T05420                                 

Gene name
fabI_1
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00061  Fatty acid biosynthesis
amih00780  Biotin metabolism
amih01100  Metabolic pathways
amih01130  Biosynthesis of antibiotics
amih01212  Fatty acid metabolism
Module
amih_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CO731_00013 (fabI_1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CO731_00013 (fabI_1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CO731_00013 (fabI_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:amih01004]
    CO731_00013 (fabI_1)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CO731_00013 (fabI_1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CO731_00013 (fabI_1)
Lipid biosynthesis proteins [BR:amih01004]
 Fatty acid synthase
  Component type
   CO731_00013 (fabI_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AWC20573
UniProt: A0A2S0XBZ3
LinkDB All DBs
Position
11304..12116
Genome map
AA seq 270 aa AA seqDB search
MDGLMKGKRGLIMGVANDHSIAWGIAQKLAQHGAELAFTYQGEAFGRRVKPLAEKVGAEI
LVPCDVEDSASVAAAFDTLREKWGGIDFLVHAIGFSDKNELKGLYADTTRENFVRTMVIS
CFSFTEVAKHAAALMNEGGSMITLTYAGSVRVMPNYNVMGVAKAGLEASVRYLANDYGPR
GIRINGISAGPVRTLAGAGISDARHMFSYQQRNSPLRRTVTLDEVGGSALYLLSDLSSGV
TGEIHYVDSGYHIVSMPTLDELKQMDGGRE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatggattgatgaagggcaagcgcgggctcatcatgggcgtcgcgaacgaccactcc
attgcctggggtatcgcgcagaagctcgcccagcacggcgccgagcttgccttcacctat
cagggcgaggccttcggccgccgcgtcaagccgctggccgagaaggtcggcgcggagatc
ctggtgccctgcgacgtcgaggacagcgcctcggtggctgccgccttcgacacgctcagg
gaaaagtggggcggcatcgacttcctggtccacgccatcggcttctccgacaagaacgag
ctcaagggtctctacgccgacaccacgcgcgaaaatttcgtgcgcaccatggtgatctcg
tgcttttcgttcaccgaagtcgccaagcacgctgcggccctgatgaacgaaggcggctcg
atgatcaccctgacctatgccgggtcggtgcgcgtcatgcccaactataacgtcatgggc
gtcgccaaggcaggcctcgaggccagtgtccggtatcttgccaacgactacggcccgcgc
ggcatccgcatcaacggcatctcggccggcccggtgcgcacgctggcaggtgctggcatc
tcggatgcccgccacatgttctcctaccagcagcgcaactcgccgctgcggcgcaccgtg
accctcgacgaggttggcggttcggcgctgtacctgctgtcggacctgtcgtcgggcgtc
accggcgagatccattacgttgattcgggctatcacatcgtctcgatgccgacgctggac
gagctcaagcagatggacggtggccgcgagtag

DBGET integrated database retrieval system