KEGG   Aminobacter sp. MSH1: CO731_00486Help
Entry
CO731_00486       CDS       T05420                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00250  Alanine, aspartate and glutamate metabolism
amih00410  beta-Alanine metabolism
amih00640  Propanoate metabolism
amih00650  Butanoate metabolism
amih01100  Metabolic pathways
amih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CO731_00486 (puuE)
   00650 Butanoate metabolism
    CO731_00486 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CO731_00486 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CO731_00486 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:amih01007]
    CO731_00486 (puuE)
Enzymes [BR:amih01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CO731_00486 (puuE)
Amino acid related enzymes [BR:amih01007]
 Aminotransferase (transaminase)
  Class III
   CO731_00486 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWC21044
UniProt: A0A2S0XDF7
LinkDB All DBs
Position
487576..488910
Genome map
AA seq 444 aa AA seqDB search
MASVWRVQGAHKVGGRAMKNAEISQRKMQTIARGVGMTTQVYADRAENSEIWDVEGRRYI
DFSSGIAVVNTGHRHPRVIEAVKAQLDRFTHTCHQVVPYESYVRLGERLNAIAPMKGDKR
TVFVTTGAEAVENAIKIARNATGRQAVIAFAGGFHGRTFMGMALTGKVQPYKAGFGAMPG
DVFHAPFPVPLHGVTVADALAALDRLFKADVDPARVAAIIIEPVQGEGGFYEVPRDFMTA
LRKICDQHGMLLIADEVQTGFARTGKMFAMDHHDVAPDLMTMAKSLAGGFPLAAVTGRAE
IMDAPNPGGLGGTYGGSPIGIAAAHAVLDVIEDEKLCDRANQLGARLKQRLESLRDDVPE
IADIRGPGFMNAVEFNDAKTKLPSADFANAVRLKALEKGLILLTCGVHGNVIRFLAPITI
QDEVMTEALDILEASIREQGRACQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggtctggcgcgtgcaaggcgcccacaaggttggaggacgagcgatgaagaac
gccgaaatctcacaacgcaagatgcagaccatcgcccgcggcgtcggcatgacgacgcag
gtctatgccgaccgggccgagaactccgagatctgggacgtcgagggccgccgctacatc
gacttctcctccggcatcgccgtggtcaacaccggccaccgccacccgcgcgtcatcgaa
gcggtcaaggcgcagctcgaccgcttcacccacacctgccaccaggtcgtgccctatgag
agctacgtccggctcggcgaaaggctcaatgccatcgcgccgatgaagggcgacaagcgc
accgtcttcgtcacgacaggcgccgaggcggtggagaacgccatcaagatcgcccgcaac
gccaccggccggcaggccgtcatcgcctttgccggcggcttccacggccgcaccttcatg
ggcatggcgctgaccggcaaggtccagccctacaaggcaggcttcggcgcgatgccgggc
gacgtgttccatgcgcctttccccgtgccgctgcacggcgtgacggtcgccgacgcgctg
gccgcacttgaccggctgttcaaggccgatgtcgatcccgcgcgcgtcgccgccatcatc
atcgagccggtccagggcgaaggcggcttctacgaggtaccacgcgacttcatgacggcg
ctgcgcaagatctgcgaccagcacggcatgcttctcatcgccgacgaggtgcagaccggc
ttcgcccgcaccggcaagatgtttgccatggaccatcacgacgtcgcgcccgacttgatg
accatggccaagagcctggccggcggcttccccctcgccgccgtcaccggccgcgccgag
atcatggatgcgcccaatcccggcggcctcggcggcacctatggcggcagcccgatcggc
attgccgcggcgcatgccgtgctcgacgtgatcgaggacgagaagctgtgcgaccgcgcc
aaccagctcggcgcgcggctcaagcagcggctggaatcgctgcgcgacgacgtgcccgaa
atcgccgacatccgcggccccggcttcatgaacgccgtcgagttcaacgatgcgaagacg
aagctgccctcggcggatttcgccaatgcggtgaggctcaaggcgctggaaaaaggcctg
atcctgctcacctgcggcgtccacggcaacgtcatccgcttcctggcgccgatcaccatc
caggacgaggtgatgaccgaggcgctcgacatcctcgaggcctcgatccgcgagcaaggc
agggcatgtcagtag

DBGET integrated database retrieval system