KEGG   Aminobacter sp. MSH1: CO731_01096Help
Entry
CO731_01096       CDS       T05420                                 

Definition
(GenBank) Sulfite exporter TauE/SafE
  KO
K07090  uncharacterized protein
Organism
amih  Aminobacter sp. MSH1
Brite
KEGG Orthology (KO) [BR:amih00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    CO731_01096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AWC21644
UniProt: A0A2S0XF49
LinkDB All DBs
Position
complement(1119483..1120238)
Genome map
AA seq 251 aa AA seqDB search
MTLITVGILFVAGFLSGVVNAIAGGGTFLTFGALTMAGLPPISANATSSIAQFPGYITST
WAYIKDIRRMWRGALAFAVISAVGALIGSLFLLSLDNVSFGALVPWLLLAATALFAAGPW
LRPARLAERPEDAPSSLAGRIVQFFTSIYGGFFGAGMGVMMLATLGLTEGGDYHRLNALK
NMLSIVIAAVAIIIFASGGVVAWAAAAVMIPGVALGGYAGVWTARRVPQAIVRALVVAVG
LFLAFYYFTKG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcatcacagtcggaatcctcttcgtcgcgggcttcctctcgggcgtcgtcaac
gccattgccggcggcggcaccttcctgaccttcggcgcgctgaccatggccgggctgccg
ccgatctcggccaatgcgacgtcgtcgatcgcccagtttcccggctacatcacctcgacc
tgggcctatatcaaggacatccgccggatgtggcgcggcgcgctcgccttcgctgtcatc
tcggccgtcggtgccctgatcggctcgctgttcctgctgtcgctcgacaatgtctccttc
ggcgcgctcgtcccctggctgctgctggccgccaccgcgctgttcgccgccggcccctgg
ctccggccggcaagacttgccgagcggcctgaagacgcaccgtcgtcactcgccggccgc
atcgtccagttcttcacctcgatctatggcggtttcttcggtgccggcatgggcgtgatg
atgctggcaaccctcggcctcaccgagggcggcgactaccaccgcctcaatgcgctgaag
aacatgctctccatcgtcatcgcagcggtcgccatcatcatcttcgcctccggcggcgtc
gtcgcctgggcggctgcagccgtcatgatccctggcgtcgcgctcggcggctatgccggc
gtctggaccgcacgccgcgtcccgcaggcgatcgtccgcgcactggtcgtcgcagtcggg
ctgtttttggcgttttactattttacgaagggctga

DBGET integrated database retrieval system