KEGG   Aminobacter sp. MSH1: CO731_01108Help
Entry
CO731_01108       CDS       T05420                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00190  Oxidative phosphorylation
amih00650  Butanoate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amih_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_01108 (sdhA)
   00650 Butanoate metabolism
    CO731_01108 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CO731_01108 (sdhA)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CO731_01108 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CO731_01108 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 DAO FAD_binding_3 FAD_oxidored HI0933_like
Motif
Other DBs
NCBI-ProteinID: AWC21656
UniProt: A0A2S0XF21
LinkDB All DBs
Position
1129152..1130987
Genome map
AA seq 611 aa AA seqDB search
MAKDGKTSGASAYTFVDHKFDVVVVGAGGAGLRATLGMAEQGLKTACITKVFPTRSHTVA
AQGGIAASLQNMGPDSWQWHMYDTVKGSDWLGDMDAMEYLVREAPAAVYELEHYGVPFSR
TEEGKIYQRPFGGHMMNYGDGPPVQRTCAAADRTGHAILHTLYGQSLKHNAQFFIEYFAL
DLIMEPDGTCTGVVAWNLDDGTIHRFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMAS
RAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYLVNAEGERFMERYAPSAKDLASRD
VVSRCMTLEIRDGRGVGKSKDHIFLHLDHLDPAVLHERLPGISESAKIFAGVDVTREPIP
VLPTVHYNMGGIPTNYWGEVLNPTAGNPDRVSPGLMAVGEAGCASVHGANRLGSNSLIDL
VVFGRAAAIRAGEVVDRNAPIPSPNAASVEKIMDRFDRLRHANGGTPTAVLREKMQRAMQ
EDAAVFRTQESLEQGCKRISQIWGEMKDIKVFDRSMIWNSDLVETLELENLMSNAIATVY
GAEARKESRGAHAREDFSARDDANWRKHTLANVAEDGEVTLTYRPVHTEPLLKEEDGGIS
LAKIAPKARVY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggacggcaagaccagcggagcatccgcctacacattcgtcgatcacaagttc
gacgtcgtcgttgtcggcgccggcggtgcgggcctgcgcgccacgctcggcatggccgag
caggggctgaagaccgcctgcatcaccaaggtgttcccgacccgctcgcacaccgttgcg
gcgcagggcggcatcgccgcctcgctgcagaacatggggcccgactcctggcagtggcac
atgtacgataccgtcaagggctcggactggctcggcgacatggacgccatggaatacctg
gtgcgcgaagcgccagccgcagtctacgagctcgagcattacggcgtgccgttctcgcgc
accgaagaaggcaagatctaccagcgcccgttcggcggccacatgatgaactacggcgac
ggcccgcccgtgcagcgcacatgcgccgcggccgaccgaaccggccacgccatcctgcac
acgctctacggccagtcgctcaagcacaacgcgcagtttttcatcgagtatttcgcactc
gacctgatcatggagccggacggcacctgcaccggcgtcgtggcctggaacctcgacgac
ggcaccatccaccgcttctcggcgaagatggttgtgttggcgaccggcggctacggccgc
gcctatttctccgccacgtcggcccatacctgcaccggcgacggcggcggcatggcctcg
cgtgccggcctgccgctgcaggacatggagttcgtgcagttccacccgaccggcatctac
ggttcgggctgcctgatcaccgaaggcgctcgcggcgaaggcggctatctcgtcaacgcc
gagggcgagcgcttcatggagcgctacgcgccgtcggccaaggacctggcgtcgcgcgac
gtggtttcgcgctgcatgacgctggagattcgtgacggtcgcggcgtcggcaagagcaag
gaccacatcttcctgcacctcgatcacctcgatccggcggtgctgcacgagcggctgccc
ggcatctcggaatcggcgaagatcttcgccggcgtcgacgtgacccgcgagccgatcccg
gtgctgccgacggtgcactacaacatgggcggcatcccgaccaactactggggtgaggtg
ctgaacccgaccgcgggcaaccccgaccgcgtgtcgcccggcctgatggccgtcggcgag
gctggctgcgcttcggtgcacggggccaaccgcctcggctccaactcgctgatcgatctg
gtggtgttcggccgcgccgcagccatccgcgccggcgaagtggtcgaccgcaacgcgcca
atcccgtcgccgaacgcggcctcggtcgaaaagatcatggaccgcttcgaccgcctgcgt
cacgccaatggcggcacgccgacggcggtgctgcgtgagaagatgcagcgcgcgatgcag
gaagacgctgccgtgttccgcacccaggagtcgctggagcagggctgcaagcgcatttcc
cagatctggggcgagatgaaggacatcaaggtcttcgaccgctcgatgatctggaactcg
gacctggtggagacgctggagctcgagaacctgatgtccaacgcgatcgccaccgtctat
ggcgccgaagcgcgcaaggaaagccgcggcgcgcatgcccgcgaggacttctcggcccgc
gacgacgccaactggcgcaagcacacgctggcaaatgtcgccgaggacggcgaggtgacg
ctgacctaccggccggtgcacaccgagccgctgctcaaggaagaagacggcggcatcagc
ctggcaaagatcgcgccgaaggcgcgggtgtactga

DBGET integrated database retrieval system