KEGG   Aminobacter sp. MSH1: CO731_01110Help
Entry
CO731_01110       CDS       T05420                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00020  Citrate cycle (TCA cycle)
amih00190  Oxidative phosphorylation
amih00650  Butanoate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
Module
amih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amih_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amih_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CO731_01110 (sdhB)
   00650 Butanoate metabolism
    CO731_01110 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CO731_01110 (sdhB)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CO731_01110 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CO731_01110 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_18
Motif
Other DBs
NCBI-ProteinID: AWC21658
UniProt: A0A2S0XF36
LinkDB All DBs
Position
1131445..1132224
Genome map
AA seq 259 aa AA seqDB search
MVELTLPKNSQIKQGKTWPKPQGATNLREYRIYRWSPDDGENPSMDTYFVDVDDCGPMVL
DHLLYIKNNIDPTLTLRRSCREGICGSCAMNIDGSNTLACTKGCDDISGAVKIYPLPHMP
VVKDLVPDLTNFYAQHRSIEPWLKTVSPEPAKEWLQSHEDRQKLDGLYECILCACCSTSC
PSYWWNGDRYLGPATLLQAYRWLIDSRDEAKGERLDNLEDPFRLYRCHTIMNCAQTCPKG
LNPAKAIAEIKKMMVERRV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgaactaacactccccaagaactcgcagatcaagcagggcaagacctggccgaag
ccgcagggtgcgaccaatctgcgcgagtaccggatctaccgctggtcgcctgacgatggc
gagaatccgagcatggacacgtatttcgtcgacgtcgacgattgcggcccgatggtgctg
gaccatttgctctacatcaagaacaacatcgacccgacgctgaccttgcgccgctcgtgc
cgcgaaggcatctgcggctcctgcgcgatgaacatcgacggctcgaacacgctggcctgc
accaagggctgcgacgacatttcgggtgctgtgaagatctacccgctgccgcacatgccc
gtggtcaaggacctggtgcccgacctcaccaatttctacgcccagcatcgctcgatcgag
ccgtggctgaagacggtgtcgccggagccggcgaaggagtggctgcagagccacgaggac
cgccagaagctcgacggcctctacgagtgcatcctgtgcgcctgctgctcgacctcgtgc
ccgagctactggtggaacggcgaccgctatctcggcccagcgacgctgctgcaagcctat
cgctggctgatcgacagccgcgacgaagccaagggcgagcgcctcgacaatctcgaggat
ccgttccggctgtatcgctgccacacgatcatgaactgcgcccagacctgcccgaagggg
ctgaacccggccaaggcgatcgccgagatcaagaagatgatggtggagcggcgggtgtga

DBGET integrated database retrieval system