KEGG   Aminobacter sp. MSH1: CO731_02653Help
Entry
CO731_02653       CDS       T05420                                 

Gene name
acoD
Definition
(GenBank) Acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00010  Glycolysis / Gluconeogenesis
amih00620  Pyruvate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CO731_02653 (acoD)
   00620 Pyruvate metabolism
    CO731_02653 (acoD)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CO731_02653 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AWC23184
UniProt: A0A2S0XJD8
LinkDB All DBs
Position
complement(2674737..2676254)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTAKVPFAKRYDNYIGGQWVAPKSGRYFENISPVTGRPLGEIARSDAADIEAA
LDAAHKAKDAWGRTSPAARALILNRIADRMEENLDLLALAETWDNGKPIRETTAADVPLA
IDHFRYFAGVLRSQEGSLSQIDDDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPAIAA
GNCVVLKPAEQTPASIMLWADLIGDLLPDGVLNIVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFQDVTSEDDDFFDKAIEGFVMFALNQGEVC
TCPSRALVHEKIYDKFMERALKRVEAIVQGDPLDPATMIGAQASSEQLEKILSYMDIGRQ
EGAEVLTGGERAHLPGDLAGGYYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDDDDALS
IANDTLYGLGAGIWSRDANRLYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETH
KMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtcgagttttcgcgcaccgccaaggtgcccttcgccaagcgctacgacaac
tacatcggcggtcagtgggtcgcgccgaaatccggccgctatttcgagaacatctcgccg
gtcaccggccggccgctcggcgaaatcgcccgctccgacgccgccgacatcgaggcagcg
ctcgatgccgcccacaaggccaaggacgcctggggcaggaccagcccggccgcccgcgcg
ctgatcctcaaccgcatcgccgaccgcatggaagaaaacctcgacttgctggcgctcgcc
gagacctgggacaacggcaagccgatccgcgagacgactgccgccgacgtaccgctggcc
atcgaccatttccgctacttcgccggtgtcctgcgcagccaggaaggcagcctgtcgcag
atcgacgacgacaccgtcgcctaccatttccacgagccgctcggcgtcgtcggccagatc
atcccgtggaacttcccgctgctgatggcctgctggaagctggcgccggcaattgccgcc
ggcaattgcgtggtgctgaagccggccgaacagacccccgcctctatcatgctgtgggcc
gacctgatcggcgacctgttgcccgacggcgtattgaacatcgtcaacggcttcggtctc
gaagccggcaagccgctggcatcgagcccgcgcatcgccaagatcgcctttaccggcgag
acgacgaccggccggctgatcatgcaatatgccagccagaacctgatcccggtgacgctc
gaactcggcggcaagtcgcccaacatcttcttccaggacgtgacatcggaggacgacgac
ttcttcgacaaggccatcgaaggcttcgtcatgttcgcactcaaccagggcgaggtctgc
acctgccctagccgcgctctcgtgcacgagaagatctacgacaaattcatggagcgcgcg
ctgaagcgcgtcgaggcgatcgtccagggcgacccgctcgacccggcgacgatgatcggc
gcgcaggcatcgtccgagcagttggagaagatcctgtcctacatggacatcggccgtcag
gaaggcgccgaggtgctgaccggcggcgagcgcgcgcatctgcccggcgaccttgccggc
ggctactacgtcaagccgaccgtcttcaagggccacaacaagatgcgcgtcttccaggag
gaaatcttcggcccggtggtgtcggtcaccaccttcaaggacgacgacgacgcgctgtct
atcgccaacgacacgctctacggcctcggtgccggcatctggagccgcgatgccaaccgg
ctctaccgcttcggccgcgccatccaggccggccgcgtgtggaccaactgctaccacgcc
tatccggcgcacgcggccttcggcggctacaagcagtcgggcatcggccgcgagacgcac
aagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctacagcccgaag
aagctcggcttcttttga

DBGET integrated database retrieval system