KEGG   Aminobacter sp. MSH1: CO731_03784Help
Entry
CO731_03784       CDS       T05420                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00061  Fatty acid biosynthesis
amih00620  Pyruvate metabolism
amih00640  Propanoate metabolism
amih01100  Metabolic pathways
amih01110  Biosynthesis of secondary metabolites
amih01120  Microbial metabolism in diverse environments
amih01130  Biosynthesis of antibiotics
amih01200  Carbon metabolism
amih01212  Fatty acid metabolism
Module
amih_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CO731_03784 (accC)
   00640 Propanoate metabolism
    CO731_03784 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CO731_03784 (accC)
Enzymes [BR:amih01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CO731_03784 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CO731_03784 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 ATPgrasp_Ter ATPgrasp_ST ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AWC24300
UniProt: A0A2S0XMK4
LinkDB All DBs
Position
3835646..3836989
Genome map
AA seq 447 aa AA seqDB search
MFQKILIANRGEIALRVLRAAKELGIQTVAVHSTADADAMHVRLADESVCIGPPPSRDSY
LNIHQIVAACEITGADAVHPGYGFLSENAKFADILAAHNITFIGPSGDHIRIMGDKIEAK
RTAKRLGIPVVPGSEGAVSDEKEAKRVAAEIGYPVIIKASAGGGGRGMKVALTEADLEVA
LQTARTEAGAAFGDDAVYIEKYLQKPRHIEVQIFGDGAGKGVHLGERDCSLQRRHQKVWE
EANSPALNAEERSRIGDICANAVANLGYSGAGTIEFLYENGEFYFIEMNTRLQVEHTITE
AITGIDLVHEQIRVASGGGLSVTQNDIRFHGHAIECRINAEDPRTFVPSPGTITHFHTPG
GLGIRVDSGVYSGYRIPPYYDSLIGKLIVHGRNRVECMMRLRRALDEFVVDGIKTTLPLF
RELVGNPDIANGDYDIHWLEKHLAKGE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttccagaaaatcctgatcgccaaccgcggcgaaatcgcgctgagagtgctccgcgcg
gccaaggagctcggcatccagacggttgctgttcactccaccgcagacgccgacgccatg
catgtgcggcttgccgacgaaagcgtctgcatcggcccaccgccttcgcgcgacagctat
ctcaacatccatcagatcgtcgcggcatgcgagatcaccggggcggacgccgtccatcct
ggctacggcttcctgtcggagaacgccaagttcgccgacatcctggccgcccacaacatc
accttcatcgggccctcgggcgaccatatccgcatcatgggcgacaagatcgaggccaag
cgcaccgccaagcgtctgggcattccggtcgttcccggctcggaaggcgctgtcagcgac
gagaaggaagccaagcgggtggccgccgagatcggctatccggtcatcatcaaggcctcc
gccggcggcggcggtcgcgggatgaaggttgccctcaccgaggcggacctcgaagtcgcg
ctgcagactgcacgcaccgaagcgggtgcggccttcggtgacgacgccgtctacatcgag
aagtacctgcagaagccgcgccatatcgaagttcagatcttcggcgacggcgccggcaag
ggcgtccatctcggcgagcgcgactgctcgctgcagcgccgccaccagaaggtctgggag
gaagccaattcgcccgccctcaacgccgaggagcgctcgcgcatcggggacatctgcgcc
aatgcggtagctaacctcggctattccggcgcaggtacgatcgagttcctctacgagaac
ggcgagttctatttcatcgaaatgaacacccgtctccaggtcgagcatacgatcaccgaa
gcgatcaccggtatcgacctcgtgcacgagcagatccgcgtcgcttccggcggcggcctg
tctgtcacgcagaacgacatccgcttccacggccatgccatcgaatgccggatcaacgcc
gaggatccgcgcacgttcgtgccctcgcccggcacgatcacgcatttccacaccccgggc
ggcctcggcatccgcgtcgattcgggcgtctattccggctatcgcatcccgccctactat
gacagcctgatcggcaagctcatcgtgcacggccgcaatcgcgtcgaatgcatgatgcgt
ctacggcgcgcgctcgacgaattcgtggtagatggtatcaagacgacgttgccgctgttc
cgtgaactcgttggcaaccctgacattgcaaatggcgactacgacatccactggctggaa
aaacatctcgccaaaggcgagtag

DBGET integrated database retrieval system