KEGG   Aminobacter sp. MSH1: CO731_04061Help
Entry
CO731_04061       CDS       T05420                                 

Gene name
glpD_2
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00564  Glycerophospholipid metabolism
amih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CO731_04061 (glpD_2)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CO731_04061 (glpD_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_binding_2 NAD_binding_8 Pyr_redox STPPase_N 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AWC24572
UniProt: A0A2S0XNC8
LinkDB All DBs
Position
4127819..4129348
Genome map
AA seq 509 aa AA seqDB search
MSIPEIHDIFVIGGGINGCGIARDAAGRGYSVYLAEMSDLASGTSSYSTKLIHGGLRYLE
HYEFRLVREALMEREVLWRNAPHIIWPMRFVLPYAKGLRPAWLIRLGLFLYDHIGGRKLL
PATRTLDMRSDAAGKPLKPMFLRAFEYSDGWVNDARLVVLNARDAADRGAVIRTRTKVTS
ARRDNGHWNILVEDLRSGQIEEVKARLIVNAAGPWIDHVLTETVGQNNVHNVRLVQGSHI
VVAKKFDDPRAYFFQNKDGRIIFAIPYEEDFTLIGTTDQDYDGDPRQAKISQAEIDYLCN
AASEYFAEPVRPEHIVWTYSGVRPLYDDGASKAQEATRDYVLKSEGRDGHAPIVNIFGGK
ITTYRRLAESMLEIIEKHLGKKGKSWTATAALPGGEFEATAFDTEVVKLKAAYPFLDMRL
ARRLTRLYGTRAKALLGLARSETDLGRNFGADLYEAEVRYLADNEWAVTAEDVLWRRTKR
GLKLGKEQAASLDEFMHGISPGVHNAAAE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatacccgagatacacgacatcttcgtcatcggcggcggcatcaacggctgcggg
atcgcacgcgacgcagctggtcgcggctactccgtctacctcgccgaaatgagcgatctg
gccagcggcacgtcttcctattcgaccaagctgatccatggcggcctgcgttatctcgag
cactacgagttcaggctggttcgcgaagcgctgatggaacgcgaggtgctgtggcgcaac
gcgccgcacatcatttggccgatgcgcttcgtcctgccctacgccaagggcctgcgtccc
gcctggctgatccggctcgggctgtttctctacgaccatatcggtggccgcaagcttctg
ccagcaacccgcacgctcgacatgcgcagcgacgccgccggcaagccgctcaagccgatg
ttcttgcgtgccttcgaatattcggacggctgggtcaacgacgcccgtcttgtggtgctc
aacgcccgcgacgcggctgaccgcggggccgtcatccgcacccgcaccaaggtgacgagc
gcgcgacgtgacaacggtcattggaacatcctcgtcgaagatctccgcagcggtcagatc
gaagaggtcaaggcgcggctgatcgtcaacgctgccggcccgtggatcgaccatgtcctg
accgagaccgtcgggcagaacaacgtccacaatgtgcgcctggtccagggcagccatatc
gtggttgcgaagaagttcgacgacccgcgcgcctatttcttccagaacaaggacgggcgg
atcatcttcgccattccctatgaggaagacttcactctcatcggcaccaccgaccaggac
tatgacggcgacccgcgccaggcaaagatcagccaggccgagatcgactacctctgcaac
gcggcgagtgaatacttcgctgaaccggtcaggccagagcatatcgtctggacctattcc
ggcgtgcggccgctctatgacgacggtgccagcaaggcccaggaagcgacgcgcgactac
gtgctgaagtccgaaggtcgcgacggccatgccccgatcgtcaacatcttcggcggcaag
atcacaacctaccggcgcctggccgagtcgatgctggaaatcatcgaaaagcacctgggc
aagaagggcaaatcctggaccgcgacggctgccctgccaggtggcgagttcgaggcgaca
gccttcgatacggaagtggtgaagctcaaggccgcctacccgtttctcgacatgcgtcta
gcacggcgcctgacccgtctctacggcacgcgcgccaaggcgttgcttggccttgccaga
tcggagacggacctcgggcgcaatttcggtgccgatctttacgaggcagaagttcgctac
ctcgccgacaacgaatgggcggtgacggcagaggatgttctttggcgacgcaccaaacgc
ggtctcaagctcggcaaggagcaggccgcgtcacttgacgaattcatgcatggaataagc
ccgggcgtgcacaacgccgcggcggagtag

DBGET integrated database retrieval system