KEGG   Aminobacter sp. MSH1: CO731_04093Help
Entry
CO731_04093       CDS       T05420                                 

Gene name
tdh_2
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
amih  Aminobacter sp. MSH1
Pathway
amih00260  Glycine, serine and threonine metabolism
amih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CO731_04093 (tdh_2)
Enzymes [BR:amih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CO731_04093 (tdh_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C HI0933_like Methyltransf_16
Motif
Other DBs
NCBI-ProteinID: AWC24604
UniProt: A0A2S0XNG7
LinkDB All DBs
Position
complement(4167413..4168447)
Genome map
AA seq 344 aa AA seqDB search
MSNMMRALVKAKAEPGIWMEEVPVPEVGPNDVLIKVRKSAICGTDVHIYNWDQWAQKTVP
VPMVTGHEFVGTVADFGAGVKDYKVGQRVSGEGHIVCGHCRNCRAGRGHLCRNTLGVGVN
RPGSFAEYVAIPQHNVVPIPDDVPDEIAAIFDPLGNAVHTALSFDLVGEDVLVTGAGPIG
IMGALVAQCVGARKVVITDINPVRLALAKKLGVHHVVDASREKLRDVMRDEGMTEGFDIG
LEMSGSAVAFRDMIDTMNNGGKIAILGIAPTGFEIDWNKVIFKMLHLKGIYGREMFETWY
KMIALVQGPLDVTGLITHRIGIDDYQAGFDAMRSGNSGKVVMDW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatgatgcgcgctctggtgaaggccaaggccgaacccggcatctggatggaa
gaggtgccggtgcccgaggtcggtcccaacgacgtgctgatcaaggtcaggaagtcggcg
atctgcggcaccgacgtccacatctacaactgggaccagtgggcgcaaaagacggtgccg
gtgccgatggtcacaggacacgagttcgtcggcacggttgccgatttcggcgccggcgtg
aaggactacaaggtcggccagcgggtctcgggcgagggccatatcgtttgcggccattgc
cgcaattgccgcgcggggcgagggcatctctgccgcaacacgctgggcgtcggcgtcaat
cgcccgggctccttcgctgaatatgtcgccattccccagcacaacgtcgtgccgatcccc
gacgacgtgcccgacgagatcgccgcgattttcgacccgctcggcaatgccgtgcacacg
gccctttctttcgacctggtcggcgaggatgtgctggtaaccggcgccggcccgatcggc
atcatgggggcgttggtggcgcaatgcgttggcgcgagaaaggtcgtcatcaccgatatc
aaccctgtccgtctggcgctggcgaaaaagctgggcgttcatcatgtggtcgatgcctcg
agggaaaagttgcgcgacgtgatgcgcgacgagggcatgaccgaagggttcgatatcggg
cttgagatgtcaggctcggcggtcgccttccgcgacatgatcgacaccatgaacaatgga
ggcaagatcgccatcctcggcatcgcgccgaccggcttcgagatcgattggaacaaggtc
atcttcaagatgctgcatctcaagggcatctatggtcgcgagatgttcgagacttggtac
aagatgatcgcgctggtgcaggggccgctcgacgtgacgggtctcatcacccatcgcatc
ggcatcgacgactaccaggccgggttcgatgccatgcgcagcggcaattccggcaaggtg
gtcatggattggtga

DBGET integrated database retrieval system