KEGG   Aminipila sp. JN-18: EQM06_09270
Entry
EQM06_09270       CDS       T05806                                 

Gene name
pylD
Definition
(GenBank) 3-methylornithyl-N6-L-lysine dehydrogenase PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
amij  Aminipila sp. JN-18
Pathway
amij00300  Lysine biosynthesis
amij01100  Metabolic pathways
amij01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amij00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    EQM06_09270 (pylD)
Enzymes [BR:amij01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     EQM06_09270 (pylD)
SSDB
Motif
Pfam: 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: QAT43388
UniProt: A0A410PWR4
LinkDB
Position
complement(2004963..2005820)
AA seq 285 aa
MWRASRYKDVGRGNEMTRLKTEWIEYMLEGMDEYNRQLKARTDMNLAELIKTTFHMKDEA
FEQAKAVNKIAVIPITQGEGIIGSFSESVAAILESMGFEALVMEHTDIDGIYEASERGCD
LLFFADDVRYLALNIKSGKVSDNNYATALGFIQGLQALMNKHGKDIHQEKILLIGYGIVG
REAEKILAKEKIDFDIFDKDDTAIKGLPYPVLTERNQIKNYPYILDFTNEGEWLKKEFLH
ADLLYASPGVPYSMDEEAKTCFEERSIHDNLEIGTAVMLGQILAD
NT seq 858 nt   +upstreamnt  +downstreamnt
atgtggagagcaagcaggtataaagatgttggaagaggtaatgaaatgaccagattaaag
acagagtggattgaatatatgctggaaggcatggatgaatacaacaggcagctgaaagcc
agaacggatatgaatctggcggagctgatcaaaacgacctttcatatgaaagacgaagcc
tttgaacaggccaaagcagtgaataagattgccgtgattcccatcacgcagggagaaggg
atcatcggctctttcagtgaatctgtggcagccattcttgaatccatggggtttgaagcc
ttggtaatggagcatacggatattgacgggatttatgaagccagcgaaagaggctgtgac
ctattgttctttgcagatgatgtccggtatctggcactgaatataaaaagcgggaaggta
tcggataacaattatgctaccgctttggggtttatccaagggcttcaggccttaatgaac
aagcatggaaaagatattcatcaggaaaaaattcttctgattggatatggcatcgtaggc
agggaagcagaaaagattctggcaaaagaaaagattgattttgatatatttgacaaggat
gataccgcaataaaggggttaccttatccggtactgacagaaagaaatcagatcaagaat
tatccctatatattagactttacaaacgaaggcgaatggctgaaaaaagaatttcttcac
gcagatcttttatatgccagccccggtgtgccgtattccatggatgaggaagcaaagacc
tgctttgaggaacgatccattcatgacaatctggaaatcggcacagctgttatgctggga
cagatcttagccgattaa

DBGET integrated database retrieval system