KEGG   Acropora millepora: 114950744
Entry
114950744         CDS       T06134                                 

Definition
(RefSeq) fibroblast growth factor 1-like
  KO
K18496  fibroblast growth factor 1
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:amil04052]
    114950744
   00536 Glycosaminoglycan binding proteins [BR:amil00536]
    114950744
Cytokines and growth factors [BR:amil04052]
 Growth factors
  Growth factors (RTK binding)
   114950744
Glycosaminoglycan binding proteins [BR:amil00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   114950744
SSDB
Motif
Pfam: FGF Fascin Coiled MIR
Other DBs
NCBI-GeneID: 114950744
NCBI-ProteinID: XP_029182714
LinkDB
Position
Unknown
AA seq 228 aa
MSFSSVGYFHILATICLLSSLSALSLAKRRHKSKESGGTEHSPTKSSSDLVKSASCGGSS
DPILTPSFIQPCYLYSRRAMMFLQILPSGKINGTNSYNSRYAELIMEVVATCMVRIRGEA
TKRYLVMEENGTLVSEAEPADETKSVFTYEIQRDFYTFKNGNYFIGFRQVGKLKRISATE
NGRNVKKNKRFVYVPRGGSRKRRDPSEERPRRSAVGRRSGHLFGDDLQ
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtccttcagcagcgtggggtactttcacattcttgctacaatttgtctgctgtcaagc
ctctcggcgttgtccttagcaaaacggcgacacaaatcaaaggaaagcggaggcacagag
cattcaccaacaaagtcctcttcagatctagtgaaatcagcatcctgtgggggctctagt
gatccaatattgaccccgagttttattcaaccatgctacttgtattcaaggcgtgcaatg
atgtttctgcagattctacccagtggcaaaatcaatggcactaattcctataatagccga
tacgctgaactgatcatggaagtcgttgcaacttgtatggtgcgaatcagaggcgaggcg
accaaacgatatctcgtcatggaggagaacggaacacttgtcagtgaggctgaaccggca
gacgaaacgaaatcagtattcacatatgaaattcaaagggacttttacacgttcaaaaat
ggaaactacttcattggattcagacaagtgggaaagctcaagagaatcagtgccacggag
aacggcagaaacgtcaagaaaaataagcggtttgtttacgtgccacgtggaggctcaaga
aaacgaagagacccgtcggaagaaagacctagacgatccgctgtcggcaggcgttccgga
catctctttggtgatgacctccagtaa

DBGET integrated database retrieval system