KEGG   Acropora millepora: 114951776
Entry
114951776         CDS       T06134                                 

Definition
(RefSeq) uncharacterized protein LOC114951776
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
amil  Acropora millepora
Pathway
amil04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:amil00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    114951776
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 114951776
NCBI-ProteinID: XP_029183742
LinkDB
Position
Unknown
AA seq 185 aa
MSFDTSDELSNRETAKRNLFGRVDHDQTRNDLQRQLRSDGEEKKRQWNFDFENCEPLPGR
YKWQRVGRRLQARKSPTETTPRNSSTGASFAENIFQDRSADTTRAEARYNLRTRGRGLEN
FSGLEFDYSRNSLCEFRSTTAAAGKKNTGNCESKRIAKERKPRSTLTNIRRKGKIPDHLA
TRRTR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgagtttcgatacttcggacgagctttcaaaccgtgagacggcaaaaagaaatctcttt
ggaagagtggatcacgaccaaactcgtaacgatctgcagcgacaattgaggagtgatgga
gaggaaaaaaaacgccagtggaattttgacttcgagaattgtgaacctctaccaggacga
tacaaatggcagcgagtgggaaggagactccaagcgcgcaaatcaccaacagaaactacg
cctcgtaattcatctacaggcgcttcatttgcggagaatatttttcaagatagatccgca
gataccacgcgcgcagaagctagatataacttgagaacaagaggacgaggattggaaaat
ttttctgggctggagttcgattattccagaaacagtttatgcgaatttcgatcgacgacg
gcagcggcgggaaaaaaaaatacaggaaattgtgagagcaaacgaattgccaaagaacgg
aaaccgagatcaacgctaaccaacatacgacggaagggtaaaattcctgaccatctggca
acaaggagaactcgttga

DBGET integrated database retrieval system