KEGG   Acropora millepora: 114954997
Entry
114954997         CDS       T06134                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
amil  Acropora millepora
Pathway
amil04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:amil00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    114954997
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:amil03000]
    114954997
Transcription factors [BR:amil03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    114954997
SSDB
Motif
Pfam: bZIP_1 bZIP_2 NRBF2
Other DBs
NCBI-GeneID: 114954997
NCBI-ProteinID: XP_029187555
LinkDB
Position
Unknown
AA seq 675 aa
MMSQTELLAWSEPDTKFFADNLLGVEDWGDSITEGKFNPDELLWENKDQGLEFESKDDHF
NEFLSSLGTYPPSPMLEDVNFTSSVCIKEEPLSPSTSNSSFTSLPSSPENQFLLNGDTSP
VHHCSVDFDLPQGNLTSLPTNIKSEAVLAPSCSVKKEQVPSVQSCSINGNVKPIKPMPGP
SIPVTIQKSPVNKPPTGIPVYIPCTGSVPANSVVSVVVGNKVNPAVPKTVLVNGSSSAEV
DAKLFKRQQRMIKNRESACLSRKKKKEYMQSLENKVKEISNLNDSLTAQNECLKRRINDL
EVENTLLRSRNPELTSTIKKSTCVLAVVLFIALNIGPFSNLKEQWKVNRGVLLPDTVVHH
GRALLNYQGGDERSDIDKPLVFGPVNQGHDRQSVTKETDISMPSILRKKTLPFKGRISQR
KDLMVVKNKWDFLGDSKHNPRNSKRKEKKSKSRRKFERKQINNSTLDEQYYCPSWFNKTE
VNRINEALDGWVKRYADERLSKQKKQRRRKTKMESSIRELALRIASNCTSDVKRMISRHK
FSRKHNSASVNAVQLFQSADTIKSFEEEINRKSDTLYVVSFRRDHLVLPATEFNSTQRPK
MSFMIMAAPNRTEWQHDGRRKTDTVTMMQIDCQVMDTKLVNIKRSSIPSQQSDSPYFSKA
SFTAPNANTFVKPAK
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgatgtcacagacagaactcttagcgtggtcagagccggacacaaaattttttgccgac
aatctgcttggagtggaagattggggagactcaattaccgaaggaaaattcaatccagac
gagttgctttgggaaaataaagatcaaggtctggaatttgaaagcaaggatgatcatttt
aatgaatttttatccagtctcggaacatatccaccttctcccatgcttgaagatgtcaat
tttacttctagtgtatgcataaaagaagaacctctctctccttcaacatctaattcttca
tttacttcgcttccaagttcacctgagaaccagttcttattaaatggagacacttcacca
gtgcatcattgcagtgtggattttgatttgccgcaaggcaatcttacctcattgccaaca
aatataaagtcagaagctgtgctcgcaccaagttgtagtgttaaaaaagagcaagtacct
agtgtgcagtcttgtagcatcaatggcaatgtgaaaccaatcaaacccatgccagggccc
tctattccagtcaccatacaaaaatccccagtcaataaacctcctactggtatcccagtt
tatattccttgcactggttcagtaccagccaacagtgttgtgtcggtagtagttgggaac
aaagttaaccctgctgttccaaagacagttctggtgaatggaagcagttctgctgaggtt
gacgcaaaattatttaaaagacaacaaagaatgataaagaacagagagtctgcctgtttg
tctcggaagaaaaagaaggagtatatgcaaagccttgaaaataaagtgaaggaaatttct
aacctcaatgactcattgacagcacagaatgagtgtttaaaaagaagaattaatgatttg
gaagtggagaatactttattgaggagcagaaacccagagcttacaagcaccattaagaag
tctacctgtgtattagctgttgttttgtttattgctctaaacattggtcccttcagtaat
ttgaaagaacaatggaaagtcaatagaggagttctgttaccagatactgtggtccaccat
ggtagagctcttttaaattaccagggaggtgacgagaggagcgacatcgataaaccactg
gtgtttggacctgtcaatcaaggacatgacagacaatcagttaccaaagaaacagacata
agcatgcctagtattttgcggaagaagacacttccttttaaaggcaggatctcacaaagg
aaggatcttatggtggttaaaaacaagtgggatttcttgggcgattcaaaacacaatcca
aggaattccaaaagaaaggagaaaaaatctaaatcaaggaggaaatttgaaaggaaacag
attaataattctacacttgatgaacagtactattgtccaagttggtttaacaaaacagaa
gtaaataggattaatgaagctcttgatgggtgggttaaaagatacgcggatgaacgcttg
tcaaagcagaaaaaacaaagacgcaggaaaaccaagatggaatcaagcatcagggaactt
gctttaagaattgcatccaactgtacttcagacgtgaagcgaatgataagcagacacaag
ttttcacggaaacataattcagcctccgtgaatgcagttcagctgttccaaagcgcagac
acaatcaagtcttttgaagaggaaattaacagaaaatctgatactctttacgttgtatct
tttcgcagagatcatttagtattgcctgcaacggaattcaactccactcaaaggcccaag
atgtcttttatgataatggcggccccaaacagaaccgagtggcaacatgatggtcgcagg
aaaacagatacggtaaccatgatgcagattgattgtcaggttatggacactaaactcgtt
aacatcaaaagatcaagtattccttcccaacaatcggactcgccctactttagcaaggcc
tcattcaccgctcctaatgcaaacaccttcgttaaaccggcaaagtaa

DBGET integrated database retrieval system