KEGG   Acropora millepora: 114966074
Entry
114966074         CDS       T06134                                 

Definition
(RefSeq) caspase-3-like
  KO
K04489  caspase 3A [EC:3.4.22.-]
Organism
amil  Acropora millepora
Pathway
amil04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:amil00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    114966074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:amil01002]
    114966074
Enzymes [BR:amil01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     114966074
Peptidases and inhibitors [BR:amil01002]
 Cysteine peptidases
  Family C14: caspase family
   114966074
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 114966074
NCBI-ProteinID: XP_029201651
LinkDB
Position
Unknown
AA seq 307 aa
MPKFTTTVTGCKNVVIGDCNSLTIDAGRTQRSQEERVFSQEDPGTSAQVHGQETSGYGID
RDQSNDNDQINYIAKTGYVLVINNVQFPGRRNPVRSGSDEDVQRLVDLFQDFRFEIRESR
DLERRDMMILLRDTSARDFTKYDCFVCVILSHGEKDGICGTDDEVITLEAITSLFRRDAC
PSLQGKPKIFLIQACRGTQRDQVSTESDSDPIFYSKPSLPADSDFLICFASAPGHECYRE
GLIGSWFICAIHKVFKEYAHKEHIMDMMLRVNNEVAGYLSPRGLKQMPCEICMLTKKVFF
QQGPNVP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgcccaaattcactactacggtaacaggatgtaaaaacgtcgtaataggcgattgcaat
tccctcactattgatgctggaaggactcaaagatcccaagaagaaagggtattttcacag
gaagatccaggaactagtgcacaagttcatggccaggaaacttctggttatggtatcgac
cgtgatcaaagtaatgataatgatcaaatcaactacatagcaaaaactggctatgtctta
gtgatcaacaatgttcagttccctggaaggagaaaccctgtacgctctggctcggatgaa
gatgtccaaaggcttgttgatctttttcaggactttaggttcgagataagagaaagtagg
gatctagaaagaagggatatgatgatcttacttagagacacttcagcaagagacttcacc
aagtatgactgctttgtgtgtgtcatcctaagccatggggaaaaagacggaatttgtgga
acagatgacgaagtgattacacttgaagccattacatctttattccgtcgtgatgcatgc
ccctcccttcaagggaaacccaaaatatttcttatacaagcttgtcgagggacccaacgt
gatcaggtttcaactgaaagtgatagtgaccccatcttttactcaaagccaagtttgcca
gcagattcagattttcttatttgctttgcttccgcacctggtcatgagtgttacagggag
ggtttaattggttcatggttcatatgcgcaatacataaagtgttcaaggagtatgctcac
aaggaacacatcatggatatgatgttaagagtgaataatgaagttgctggttatttaagc
cccagaggcctcaagcaaatgccatgtgagatatgcatgcttacaaagaaagtgttcttt
caacaaggaccgaatgtaccttga

DBGET integrated database retrieval system