KEGG   Acropora millepora: 114967172Help
Entry
114967172         CDS       T06134                                 

Definition
(RefSeq) caskin-2-like
  KO
K21952  CASK-interacting protein
Organism
amil  Acropora millepora
Brite
KEGG Orthology (KO) [BR:amil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:amil04131]
    114967172
Membrane trafficking [BR:amil04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    114967172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank_3 Ank_5 Ank SAM_1 SAM_2 SH3_2 SH3_1 SH3_9 GP67
Motif
Other DBs
NCBI-GeneID: 114967172
NCBI-ProteinID: XP_029203003
LinkDB All DBs
Position
Unknown
AA seq 1217 aa AA seqDB search
MAKDQELLQAVKSNDLGVFRKLVAKIKAAKAKKGGKKYNVNVQDENGFTAFHHAALTGNI
EVVRSLIELQSDINVRDHKGMSPLHLAAWSGKVEVTLLLLEVGANVNACSDNGDTPLILA
CQHGNSDVTELLLDKGCNSWTTNKNGESALDLACRFGHVHVVKLLLKSKEVRSILTSGEP
QKTDPPLHLASKAGHVEIVRMLLEADADINHVTKNGSCLHESALYGKTEVVKLLLEWGID
SNVVNDEGHTALEEVNLFTSSNASSEIKHILKEAAAADKTIYAKAVRDHFNVMDSTALCF
KAGDTIVVLEQNQSDRWKGKIQNGEREKVGFFPGNFVRITTPRRGAKVSGKRSSIQLPMQ
PPTMQKASYAMVPVAPVPAPTSEFNRNSTRLMSFGKKERRQRNDDNEDPSSGTDSIKALV
EPALPEKGLKAKQPSIKMGTGLQYVEVAVEENPASPLNLYSGGGQMNGKTQYTEVRLPLN
ASMEEEEVCAEVPTLPRKNSTKLSTFGKSEDIWVRNTPDTRLPSLPPKIRTKSQVSDSDR
PVTQSAHPPAPFPEDSLNLVGVTGPSKPVVSPALSRKGYEEMNPALLPGGRETPPMVEDI
WKPQPTKSGGHKHQPLAYENVSVPSHKAKSPNDLHSVIISDVDQQGEGDDDYILVNQQLS
KPNDPRAYENVTPGRLTTGYVTQESVTSGASTPPVNRSYENIATPKKDWNYVSMKEGVPD
SSGNNGSHSDKEDTQAFDYEIMTSGATPTVFPSYVNITRQENGTSALAESSSSLPALKMR
EYNALFDWLEKFKLTIYIDNFVNGGFDMTSVCGITAEDLTAINIKKTGHRKKILSESRKL
EGTAVFPTDKPVNIMKWLHLIGLQQYIPEFMDGGFDDMDFVHDMTLEDLVTIGVTKTGHQ
RKIWMAVNALKSGDENENVSEKQTGTSVQESESQERKGYLETCLDGDDSGVSTDEVELDN
ARTEDSEMDFPPPPVFVRENTGEELFGEDSSSAESEIPEQSAEPLSGKEASEERLDLEET
LVSQEVPQMPDLEISQPSAKQEQNNIRKQPNISLMVHGGDTQSSPESEDDEPPPRPPPPM
EPMDISLPLHDVNHEGAVKSVQDMVLRENERIRSFSLDSSFKRSTVSPVPPPTKPKNFKK
PPPPAVKPKPRKARSFAGSGGRSSSDDNSNERWPKAPLSDTDSRGSIGSNTVSSESTPSS
PNGSXSHWERKSSSESY
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaccaagagttacttcaggctgtaaaatccaacgacctcggagtgttcagg
aaacttgtggcaaagatcaaagccgctaaagcaaaaaagggaggcaagaagtacaatgtc
aatgtacaagatgagaatgggtttactgctttccaccatgctgctctgactggaaacatc
gaagttgttcgtagcttaattgaactgcagtccgacatcaatgtgagagatcacaaaggg
atgtcgcctttgcatttagcagcatggtctggaaaagttgaagtaactctacttctgttg
gaagttggagctaacgttaatgcctgctctgacaatggagatactcctttgatcttggca
tgtcagcatggaaattctgatgtgacagagttgcttctggacaaaggctgtaactcctgg
accacaaacaagaatggagaatctgctttagatcttgcttgcagatttggacatgtgcat
gttgttaagcttcttttgaagtcaaaagaagtgagaagtatattaacaagtggtgaacca
cagaagactgatcctccattacacctggcttccaaagcaggccatgtggaaatagtaaga
atgttgctagaagccgatgcagacataaaccatgtgacgaaaaatggttcttgtttacac
gaatcagctctttatggtaaaacagaggtggtaaagttactcctggagtggggaattgac
tctaatgtggtcaacgacgaaggccacactgctctggaagaagtcaatctcttcacaagc
tctaatgcctcgtcagaaattaaacatattctgaaagaggctgctgcggcggataagact
atttatgctaaagctgtccgagatcatttcaacgtgatggattcaacagcgctgtgcttc
aaggctggcgatactattgttgttttagaacaaaaccagagtgacagatggaaaggaaaa
attcaaaatggagagagagaaaaagttggatttttccctggcaactttgtccggattacc
acaccaagacgaggcgcaaaagtttcaggcaagaggtcgtcaatacaactgcccatgcag
cctcccactatgcaaaaggcatcgtatgcgatggttcctgtagccccagtgccagcaccg
acatctgaattcaacagaaattctactcggctgatgagttttggtaaaaaggaaagacgt
caacgcaatgatgataacgaagacccaagctccggcactgattctataaaggcccttgtg
gagccggccttacctgaaaaaggacttaaagcgaaacagccctcaattaaaatgggcacg
ggcttgcagtacgtagaagtagcggtggaggaaaatccagcctctcctcttaatttatat
tcgggcggagggcaaatgaacggcaaaactcaatatactgaagttcgtttgccgcttaat
gcatcaatggaagaggaagaggtgtgtgcggaggttccgactcttcctcgtaaaaacagt
acgaaactttcaacgtttggtaaatcggaggacatctgggtacgaaatacgcccgacacc
cgactaccttcgcttccgccgaaaatacggactaagagccaggtttccgattctgacaga
ccagtgactcaatcagctcatccacccgcaccgttcccagaagactccttaaatctcgtg
ggtgtcacgggaccttctaagcccgtggtgtctcctgcattgtcacgcaaaggatacgag
gaaatgaacccagctctgttgcctggcgggcgagaaactccgcctatggttgaagacatc
tggaaaccgcaacccactaagtcgggagggcataagcaccagccattagcgtatgagaat
gtgagcgtgccgtcacacaaagcaaagtctccaaacgatttgcatagtgtgattatttcg
gacgttgatcaacagggggagggtgacgatgattatattcttgtcaaccaacagctctcc
aaaccaaatgatcctagagcctatgagaatgtcacgccaggtagactcacgacaggatat
gtcacacaggagtctgtcacgtccggtgcttccacccctcccgtgaatcgctcttacgag
aatattgcgacaccaaagaaggattggaattatgtttcaatgaaagaaggtgttccagac
tcttcaggcaataatggttctcattctgataaagaagacacacaagcctttgattatgaa
atcatgacaagcggtgcgacaccaactgtttttccatcttatgtcaatatcacaagacaa
gaaaatggcacgagcgctctcgcagaatcttccagcagtttgcctgcacttaagatgcga
gagtacaacgcgctctttgactggctggaaaaatttaaactgacgatttatatcgataat
tttgtcaatggaggctttgacatgaccagtgtatgtggaatcactgcggaggatttgaca
gctattaatatcaagaaaactggacacaggaagaaaatattgtcggaatcaagaaagcta
gagggaacggcagtatttcctaccgataaaccagtcaatattatgaagtggctgcatttg
attgggttacaacaatacataccggagtttatggacggtggatttgatgatatggatttc
gttcatgatatgacgctagaggatttagtaaccatcggagttacaaaaacaggtcatcaa
aggaaaatatggatggctgttaatgcgctcaagtctggggatgagaatgaaaacgtatcg
gaaaaacagactggaactagtgtacaagaaagcgagtcgcaagaaaggaaaggctattta
gagacttgtttagacggagacgattctggcgtttctacggatgaagtcgaacttgacaac
gcgcgaacggaggacagtgaaatggactttcctcctcctcctgttttcgtaagagaaaat
accggcgaggaattatttggcgaagattcttcgtcggcagagtccgagattccagaacaa
tccgccgaaccgttgtctgggaaagaagcttctgaagaacggttagatcttgaggagact
ttggtttctcaagaagttccgcagatgcctgatcttgaaattagtcagccctccgcaaaa
caggagcaaaataatatcagaaaacaaccgaacatttcattaatggttcacggcggggat
acgcaatcgtctcctgaaagcgaagacgacgagcctccaccgcgtcctccaccgccgatg
gagcccatggacatttctttgcccctacacgacgtcaatcatgaaggggccgtgaagtcc
gtacaggatatggtgctcagagaaaacgaaagaatacgatcattttctctagattcatct
tttaagaggtccacggtatctcctgttcctccgcctactaaacctaaaaactttaagaag
ccccctccacctgcagtgaaaccgaagcctcgcaaagctcgttcgtttgcaggatcagga
ggaaggagttcaagtgacgacaattccaacgaaaggtggccaaaagcacctctctctgac
acggacagtcgtggcagcataggctccaacaccgtgtcttctgagtccaccccctcctct
cccaatggctcgnggtctcactgggagcgaaagagttcgagtgagagctattag

DBGET integrated database retrieval system